KEGG   Saccharomyces cerevisiae (budding yeast): YNL175CHelp
Entry
YNL175C           CDS       T00005                                 

Gene name
NOP13
Definition
(RefSeq) Nop13p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 GNAT_acetyltr_2
Motif
Other DBs
NCBI-GeneID: 855547
NCBI-ProteinID: NP_014224
SGD: S000005119
UniProt: P53883
Position
XIV:complement(307401..308612)
Genome map
AA seq 403 aa AA seqDB search
MSETELSKEDAVTKKDNEEQVKKALLDPTKKRKAEDEIEIDLKSSIPLSKKQKRLLRRGK
VTLEELNAKYNIDPKSIEEYKEDAEKKKSGASEKDAQGEESTINTPTGDESGEVVKKKKK
DENKYGVWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAM
KNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRI
LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK
SCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRNNSSSFDISNNKGYDRAGQDNGSKPEYK
RSNANRRPPVDSNNRTKSSVALATAQRGSAAIVPSQGKKVKFD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacagaactgtcgaaagaagatgctgttacaaaaaaggataacgaggaacaa
gtcaagaaggctttactcgatccaacaaaaaagagaaaagctgaagatgaaattgagatt
gacctgaaaagctccattcccctatcaaaaaaacagaaacgtctcttgagaagaggtaaa
gttactctagaggagttgaatgcgaagtacaatatcgaccctaagtcaatcgaggaatac
aaagaagatgctgaaaagaaaaagtctggtgcttctgagaaagacgcccagggtgaagaa
tctacaatcaacactccaacaggagatgaatctggcgaggttgtaaaaaagaagaagaaa
gatgaaaataaatatggtgtttggattggtaacttatccttcgacaccacaaaggacgat
ttagtaagattttttattgctaaaacaaaagacaacgaagatgaaaagagcagagtcacc
gaacaagacataaccaggttatccatgcctcgtgttgctgccaagaactctaacgccatg
aaaaataagggattttgctacatgtttttcaagaacgtcgagcagatgaaagcggtctta
gaattatctgaatctcatttaaacggaaggaatatgctaatcaaggactccgaaaattat
tcaggtaggccagacaaggacgatttagttgccatgtccaaaaatccaccgtcaaggatt
ctatttgtcggtaatttgtcattcgatgtcacagatgatctgttaagaaaacacttccaa
cattgtggtgatatcgtgaaaatccgcatggcaacattcgaagatagtggtaaatgtaaa
ggattcgcatttatcgacttcaagaatgaagaaggatctactaatgcattaaaggataaa
agttgtagaaaaattgccggaaggccattgcgaatggaatacggtgaagatagaagtaaa
agacaagttcgtaagaaggttgaaaatgtatccagaaacaattcctcatcatttgatatc
tctaacaacaaaggatacgatcgtgcgggacaggataacggcagcaaacccgaatacaag
cggtccaacgccaacagacgtccacctgtagattccaataaccgaactaagagcagtgta
gctttagccactgctcagagaggttctgcagctattgtcccatcacaaggtaagaaagtg
aagtttgactaa

DBGET integrated database retrieval system