KEGG   Saccharomyces cerevisiae (budding yeast): YNL177CHelp
Entry
YNL177C           CDS       T00005                                 

Gene name
MRPL22
Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL22
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 855544
NCBI-ProteinID: NP_014222
SGD: S000005121
UniProt: P53881
Position
XIV:complement(303686..304615)
Genome map
AA seq 309 aa AA seqDB search
MNFHTARISQVGVISRALLSSVSRRWIHVTPISLNNSGGSLFGSITENKPKEGKNRGDED
AGSFSNRLAIASDSSGEAPEVNRDSITIENDKLLQQHIISLQQPEQLASQSLLSPLKREI
YEANCKINGGFYKKDTIVKLPNSSERYKLKLTKREIEVLEPSVYAQSYRIKSSMKKATLL
LRLLGGLDVMKAISQCHFSNKKIAREVAELLQKGVKDGQKLGLKPEDLYISQIWTGSDGF
WRKRVEFKARTRIGIISHPYIHVRCILRTKSVTKRRLAYEAHLKEQKRAPWVQLGDKPIR
GVTGGVYKW
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccacacggcaagaatatctcaggtcggtgtcatttctagggctctactttct
tctgtaagtagacgttggattcatgtaacgccaataagtcttaataattcaggaggatca
ctattcggaagcattacagaaaataaaccaaaggaaggaaaaaacaggggggatgaagat
gcaggcagcttctctaataggttagcgattgcttctgattcttctggagaggctcctgaa
gttaatagggattcaataaccatagaaaacgataaactactacagcaacatatcatatcg
ttgcagcaaccggaacaattagcatcacagagcttattatctcctttgaaaagggaaata
tatgaagctaattgtaaaattaatggtgggttttacaagaaagatactattgtaaagtta
ccaaattctagcgaacgttacaagctaaagttaacaaaaagagaaattgaagtactagaa
ccttccgtatatgctcagtcatatagaattaaatcgtcgatgaaaaaggctacacttttg
ttgaggttattgggaggcctcgacgttatgaaagctatatctcagtgtcacttttctaat
aagaaaattgctcgcgaagtagcagaactacttcaaaaaggtgtaaaagatggccaaaaa
ttaggtttgaaaccagaggacttatatatctctcagatttggacagggagtgacgggttt
tggagaaaacgtgttgaattcaaggcaaggacaagaatcggaatcataagtcatccttac
atacatgtcagatgtattctgagaacaaagagtgttacgaaacgaagacttgcttatgaa
gcacatttaaaagagcaaaaaagagcgccatgggtacagttgggagataagcccattagg
ggtgttacaggcggcgtatacaagtggtga

DBGET integrated database retrieval system