KEGG   Saccharomyces cerevisiae (budding yeast): YNL178WHelp
Entry
YNL178W           CDS       T00005                                 

Gene name
RPS3, SUF14
Definition
(RefSeq) ribosomal 40S subunit protein S3
  KO
K02985  small subunit ribosomal protein S3e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YNL178W (RPS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YNL178W (RPS3)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YNL178W (RPS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S3_C KH_2
Motif
Other DBs
NCBI-GeneID: 855543
NCBI-ProteinID: NP_014221
SGD: S000005122
UniProt: P05750
Structure
PDB: 

Position
XIV:302680..303402
Genome map
AA seq 240 aa AA seqDB search
MVALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLG
ENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAY
GVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQG
VLGIKVKIMRDPAKSRTGPKALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctttaatctctaagaaaagaaagctagtcgctgacggtgtcttctacgctgaa
ttgaacgaattcttcaccagagaattagctgaagaaggttactccggtgttgaagtccgt
gtcactccaaccaagaccgaagttatcatcagagctaccagaactcaagatgttttgggt
gaaaacggtagaagaatcaacgaattaactttgttggttcaaaagagattcaagtacgct
ccaggtactattgtcttatatgctgaaagagttcaagaccgtggtttgtccgctgtcgct
caagctgaatctatgaaattcaaattgttgaacggtttggctatcagaagagctgcttac
ggtgtcgtcagatacgttatggaatctggtgctaagggttgtgaagttgttgtttccggt
aaactaagagctgccagagctaaggctatgaaatttgctgacggtttcttgattcactct
ggtcaaccagtcaacgacttcattgacactgctactagacacgtcttgatgagacaaggt
gttttgggtatcaaggttaagattatgagagacccagctaagagcagaactggtccaaag
gctttgccagatgctgtcaccatcattgaaccaaaagaagaagaaccaattcttgctcca
tctgtcaaggactacagaccagctgaagaaactgaagctcaagctgaaccagttgaagct
tag

DBGET integrated database retrieval system