KEGG   Saccharomyces cerevisiae (budding yeast): YNL192WHelp
Entry
YNL192W           CDS       T00005                                 

Gene name
CHS1, USA4
Definition
(RefSeq) chitin synthase CHS1
  KO
K00698  chitin synthase [EC:2.4.1.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YNL192W (CHS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YNL192W (CHS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.16  chitin synthase
     YNL192W (CHS1)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Structural polysaccharide
   YNL192W (CHS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chitin_synth_1 Chitin_synth_1N Chitin_synth_2 Glyco_trans_2_3 Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 855529
NCBI-ProteinID: NP_014207
SGD: S000005136
UniProt: P08004
Position
XIV:276502..279897
Genome map
AA seq 1131 aa AA seqDB search
MSDQNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQ
SLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQ
QLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTS
PSIASSSDGYADQEARPILEQPNNNMNSGNIPQYHDQPFGYNNGYHGLQAKDYYDDPEGG
YIDQRGDDYQINSYLGRNGEMVDPYDYENSLRHMTPMERREYLHDDSRPVNDGKEELDSV
KSGYSHRDLGEYDKDDFSRDDEYDDLNTIDKLQFQANGVPASSSVSSIGSKESDIIVSND
NLTANRALKRSGTEIRKFKLWNGNFVFDSPISKTLLDQYATTTENANTLPNEFKFMRYQA
VTCEPNQLAEKNFTVRQLKYLTPRETELMLVVTMYNEDHILLGRTLKGIMDNVKYMVKKK
NSSTWGPDAWKKIVVCIISDGRSKINERSLALLSSLGCYQDGFAKDEINEKKVAMHVYEH
TTMINITNISESEVSLECNQGTVPIQLLFCLKEQNQKKINSHRWAFEGFAELLRPNIVTL
LDAGTMPGKDSIYQLWREFRNPNVGGACGEIRTDLGKRFVKLLNPLVASQNFEYKMSNIL
DKTTESNFGFITVLPGAFSAYRFEAVRGQPLQKYFYGEIMENEGFHFFSSNMYLAEDRIL
CFEVVTKKNCNWILKYCRSSYASTDVPERVPEFILQRRRWLNGSFFASVYSFCHFYRVWS
SGHNIGRKLLLTVEFFYLFFNTLISWFSLSSFFLVFRILTVSIALAYHSAFNVLSVIFLW
LYGICTLSTFILSLGNKPKSTEKFYVLTCVIFAVMMIYMIFCSIFMSVKSFQNILKNDTI
SFEGLITTEAFRDIVISLGSTYCLYLISSIIYLQPWHMLTSFIQYILLSPSYINVLNIYA
FCNVHDLSWGTKGAMANPLGKINTTEDGTFKMEVLVSSSEIQANYDKYLKVLNDFDPKSE
SRPTEPSYDEKKTGYYANVRSLVIIFWVITNFIIVAVVLETGGIADYIAMKSISTDDTLE
TAKKAEIPLMTSKASIYFNVILWLVALSALIRFIGCSIYMIVRFFKKVTFR
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcaaaataatcgatcgagaaatgaatatcactcaaaccggaagaatgaacct
tcctatgaactccaaaatgcacatagcgggctatttcactcttctaatgaagaattaaca
aacaggaaccaaagatataccaatcaaaatgccagcatgggttcattcactccagtccaa
tctttgcaatttccagaacaatctcagcaaacaaatatgctttataacggtgacgatggc
aataataatactatcaatgataacgaacgagacatatatggaggttttgtcaaccaccat
cgccagcgtcccccaccagcaactgcagaatacaatgacgtttttaatacgaatagtcaa
cagctaccgtcggaacatcaatacaataacgtaccttcatatccacttccttcgataaat
gtgattcaaaccactccagaactcatacataacggctcacagactatggccacccccatc
gaaaggcccttctttaacgaaaacgactactattataataacaggaactctaggacgtca
ccgagtattgcttctagtagcgatggttatgcagatcaggaagctaggcccattttggag
caacccaacaataacatgaatagcggtaatattcctcaataccatgaccaaccttttgga
tacaacaatggttaccatggcctacaggcaaaagattactatgacgatccggagggtggt
tatattgatcagagaggagatgactatcagattaattcatatttgggtagaaacggtgaa
atggttgatccttacgattatgaaaacagtttaagacatatgactcctatggagcgtaga
gaatatcttcatgatgatagcagacccgtaaacgatggaaaagaagaattagacagtgtg
aaaagcggttactctcatagagacttgggggaatatgacaaggatgatttttcaagggat
gacgagtacgatgatctcaacactattgataaattacagtttcaagctaatggtgtacct
gcatcatcctcggtgtcttctatcggatctaaagaatccgacataatagtaagcaatgat
aacttaaccgcaaatagagcactaaagagaagcggtactgaaattaggaaattcaaactt
tggaatggtaattttgttttcgattctccaatcagtaagacgctattggaccaatacgct
actacaacagaaaatgcaaacactttaccaaatgagtttaagtttatgagatatcaagca
gttacttgcgaacctaatcaacttgcagagaagaatttcacggtgaggcagttgaagtat
ttaactccaagggaaacggaattgatgctagtagtcacaatgtataatgaagaccatatc
ctgttaggaagaactttgaaaggtattatggacaatgtcaaatatatggtgaaaaaaaaa
aattcaagcacttgggggccggatgcatggaaaaagattgtcgtttgtatcatttcagat
ggtagatccaaaattaatgaacgctcgctagcattactaagttcgttaggttgttaccag
gacgggtttgctaaggatgaaattaatgaaaaaaaagtggcaatgcatgtctacgaacat
acgacaatgatcaacatcacaaatatttcggaatcagaggtttcattagaatgcaatcaa
ggtaccgttccaatacaacttttgttttgtttgaaagagcaaaatcagaaaaaaattaac
tcacatagatgggcatttgaaggctttgcagaattactgcgtcccaatatcgttacattg
ttagatgctggtaccatgccaggtaaagattctatttaccagttatggagagagttcagg
aatccaaatgttggtggcgcatgtggtgaaataagaactgatttgggtaagagatttgta
aagcttttgaatcctttagttgcatcacagaatttcgaatacaaaatgtccaatatttta
gacaaaacaaccgagtctaactttggatttattactgttctaccgggggcattctctgcg
tataggtttgaagctgtgagaggccaaccattacagaagtacttttatggtgaaattatg
gaaaatgaaggttttcattttttttcttccaatatgtatcttgctgaagatcgtatttta
tgctttgaagtggtcacaaaaaaaaattgtaattggattttgaaatactgcagaagttct
tatgcttcaacagatgtaccggagagggtccctgaatttattcttcagaggaggcgttgg
ttgaatggttcattttttgctagtgtatattccttttgtcatttttacagagtctggagc
agtggtcataatattggtagaaaactccttttgacggttgaatttttttaccttttcttc
aatacattgatttcatggttttcattgagttcatttttcctagtctttagaattctcact
gtttctattgcactggcataccattcagcatttaatgtgttgtccgtcatattcctgtgg
ctttatgggatttgtaccttatcaacattcatactgtcattgggtaataaacctaaaagt
actgagaaattttatgttctaacttgcgtcatttttgcggtgatgatgatttacatgata
ttctgcagtatattcatgagtgtcaaatccttccaaaatatattgaaaaacgataccatc
agctttgagggtttgattaccacagaagctttcagggatattgttatctctctgggctcc
acttattgtttgtacctaatcagttcaattatctatttgcagccatggcatatgttgaca
agttttattcagtatattttattgagtccttcttacatcaatgttttgaatatctatgca
ttttgtaatgtccacgacttatcatggggtacaaagggtgcaatggcaaatccgctgggt
aagattaatactacagaagatggtacgttcaaaatggaagttctggtctctagttcagag
attcaagcaaactacgataaatatttgaaagttttaaatgacttcgatccaaaatcagaa
tctcggcctactgagccatcttatgatgaaaaaaagactggctattatgcaaacgttaga
tctctcgtgattatcttttgggtcatcacaaatttcatcatcgttgctgttgtcttagaa
accggtgggattgcagattatattgctatgaaatccatatcaactgatgacactttagaa
actgcaaagaaggcggaaattcccttaatgaccagtaaggcctcaatttattttaatgta
attttatggttagttgcattatcggcattaataaggttcattggttgctcaatatacatg
atagtaaggttttttaaaaaggttacatttcgctaa

DBGET integrated database retrieval system