KEGG   Saccharomyces cerevisiae (budding yeast): YNL209WHelp
Entry
YNL209W           CDS       T00005                                 

Gene name
SSB2, YG103
Definition
(RefSeq) Hsp70 family ATPase SSB2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
sce04141  Protein processing in endoplasmic reticulum
sce04144  Endocytosis
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YNL209W (SSB2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YNL209W (SSB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YNL209W (SSB2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YNL209W (SSB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YNL209W (SSB2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YNL209W (SSB2)
   03009 Ribosome biogenesis [BR:sce03009]
    YNL209W (SSB2)
   03110 Chaperones and folding catalysts [BR:sce03110]
    YNL209W (SSB2)
   04131 Membrane trafficking [BR:sce04131]
    YNL209W (SSB2)
   03051 Proteasome [BR:sce03051]
    YNL209W (SSB2)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL209W (SSB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YNL209W (SSB2)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     YNL209W (SSB2)
Spliceosome [BR:sce03041]
 Complex B
  Other components
   Prp19 complex
    YNL209W (SSB2)
 Complex C
   Prp19-CDC5 complex
    YNL209W (SSB2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YNL209W (SSB2)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP70 / DNAK
   YNL209W (SSB2)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    YNL209W (SSB2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    YNL209W (SSB2)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    YNL209W (SSB2)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    YNL209W (SSB2)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YNL209W (SSB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 855512
NCBI-ProteinID: NP_014190
SGD: S000005153
UniProt: P40150
Position
XIV:252059..253900
Genome map
AA seq 613 aa AA seqDB search
MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPQERLIGDAAKNQ
AALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQE
ISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNL
LEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL
TRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDVAPLSLGVGMQGDIFGIVVPR
NTTVPTIKRRTFTTVSDNQTTVQFPVYQGERVNCKENTLLGEFDLKNIPMMPAGEPVLEA
IFEVDANGILKVTAVEKSTGKSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKH
EARQRLESYVASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV
GLKRVVTKAMSSR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggtgttttccaaggtgctatcggtatcgatttaggtacaacatactcttgt
gttgctacttatgaatcttccgttgaaattattgccaacgaacaaggtaacagagttact
ccatctttcgttgccttcaccccacaggaaagattgatcggtgatgctgccaagaaccaa
gctgctttgaacccaagaaacactgtttttgatgctaagcgtttgattggtagaagattc
gacgacgagtctgtccaaaaggacatgaagacctggcctttcaaggttatcgacgtcgat
ggtaacccagtcattgaagtccaatacttggaagaaaccaagactttctccccacaagaa
atttccgctatggtcttgaccaagatgaaggaaattgctgaagctaagattggtaagaag
gttgaaaaggctgtcattactgtcccagcttactttaacgatgcccaaagacaagctacc
aaggatgccggtgccatttctggtttgaacgttttgcgtatcatcaacgaacctactgcc
gctgctattgcttacggtctaggtgctggtaagtccgaaaaggaaagacatgttttgatt
ttcgatttgggtggtggtactttcgatgtttccttgttgcacattgctggtggtgtttac
actgttaaatctacttccggtaacactcacttgggtggtcaagatttcgacaccaacttg
ttggaacacttcaaggctgaattcaagaagaagactggtttggacatctccgacgatgcc
agagctttgagaagattgagaactgctgctgaaagagctaagagaaccttatcttctgtc
actcaaactaccgttgaagttgactctttgtttgacggtgaagatttcgaatcctctttg
actagagctagatttgaagacttgaacgccgcattgttcaagtctactttggaacctgtt
gaacaagttttgaaggatgctaagatctctaagtctcaaatcgacgaagttgtcttggtt
ggtggttctaccagaattccaaaggtccaaaagttgttgtctgacttctttgacggtaag
caattggaaaaatctattaacccagatgaagctgttgcttacggtgctgctgttcaaggt
gctatcttgactggccaatccacatctgacgaaaccaaggacttgttgttgttagatgtt
gctccattatctctaggtgttggtatgcaaggtgacattttcggtattgttgtcccaaga
aacacaactgttccaaccatcaagagaagaaccttcacaactgtcagtgacaaccaaacc
accgttcaattcccagtctaccaaggtgaacgtgtcaactgtaaagaaaacactttgttg
ggtgaattcgacttgaagaacatcccaatgatgccagctggtgaaccagtcttggaagct
atcttcgaagttgatgctaacggtatcttgaaggttactgccgtcgaaaagtctaccggt
aagtcttctaacatcactatctccaacgctgtcggtagattgtcttctgaagaaattgaa
aagatggttaaccaagccgaagagttcaaggctgctgatgaagcttttgctaagaagcac
gaagctagacaaagactagaatcctacgtcgcttccatcgaacaaaccgtcactgaccca
gtcttgtcttctaaattgaagagaggttccaagtccaagatcgaagctgctttgtccgat
gctttggctgctttgcaaatcgaagacccatccgctgatgagttgagaaaggcagaagtt
ggtttgaagagagttgtcaccaaggccatgtcttctcgttaa

DBGET integrated database retrieval system