KEGG   Saccharomyces cerevisiae (budding yeast): YNL212WHelp
Entry
YNL212W           CDS       T00005                                 

Gene name
VID27
Definition
(RefSeq) Vid27p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VID27 VID27_N VID27_PH
Motif
Other DBs
NCBI-GeneID: 855509
NCBI-ProteinID: NP_014187
SGD: S000005156
UniProt: P40157
Position
XIV:247461..249809
Genome map
AA seq 782 aa AA seqDB search
MNILKKFMESGNKPELITIPSGQFNLLRSKNSPKAALECIYNNATLSVRKIGKFDYELAV
YRVEDDSEGGTGDEAENFEDDTISVLSTQSKKKEEEWSVEISDKIMFHKTWDKQGNVALV
WENLRGDEQDEKVQFVVAADVSFSDVEQFIQTVYRCQFEVRNKKSSLTASADDLKEIEHR
STRLFVQDDDDELDSSSDDFQDAKDTSFEHEKESEILERTPSPLKKVPEGEYCCLVMSSL
YMYDPIQEKFILQEPVVKVAIIDTGKYEFWLAIEGKDNRLGTQVAPNINPTFELATDAFL
FNYTLQNITLSYMLKFKDLDKCIQFRFAWVKCLWMTLNKETWTDVPEKEKDYILDSSSVP
LEKQFDDILHIDDRSNEERDKESSESENDSEDEDDENDHSKRIISSEAFEEPRRATSKGN
SSLTVAFRNNRSYVTRDNRIGVFKTDDEDDSLEFVAAIKNISNLGGKSIDPHKPMLYMED
RNLILTDGENENKLYKMDIERGKVIEEWSTGDKNVVQYGPTKKFDQMTPEQTIVGVSQKG
VFKIDPRINGKNKIAVDESKDYVGKYNFSSIGTTESGYIAIGSEKGDIKLYDRLGIRAKT
AIPSLGQAIKFITTSADGKWLLATCESTLLLMDLKIKDGKNAGNIGFLKSFPASENVKTY
VLKIRPEHSASILTYTKKPIRFTKAYFNTGIGQQEQTIVTSTGPYAISWSLKGILNQDGS
NNYPYRIRRYNADVVADNFEFGSDKKVIVALKDDVSLSKVKSFKQPSKGVLMPSASLQDF
YG
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttgaagaagtttatggagtctggtaacaagccagagctcatcacgatacct
tctgggcagtttaatcttttgaggtctaagaattcccctaaagctgctttagaatgtatt
tacaacaatgcaactttaagcgtacgtaaaataggcaaatttgattatgagttggcggtt
tatagggtagaggacgatagtgaaggaggcacgggagatgaggctgagaattttgaagac
gacaccatcagtgttttatccacacagtctaaaaagaaagaagaggagtggagcgttgaa
atatcggataaaatcatgtttcacaaaacatgggataaacaaggaaacgtggcgcttgtg
tgggagaacttaagaggtgatgaacaagatgaaaaggttcaatttgttgttgccgctgat
gtgtcgttttctgatgttgaacagtttatccaaactgtttaccgatgccaattcgaagta
aggaataaaaaatcctctctcactgcctcagcagatgacttaaaggaaatagagcataga
tcaaccaggctctttgttcaagatgatgatgacgagttagattcaagctcagatgacttt
caagatgctaaagacacctcttttgagcacgagaaggaaagtgaaatattggaaagaact
ccttctccattgaaaaaagttccagaaggggaatattgttgtttagtgatgtctagccta
tacatgtatgatccaattcaagaaaaatttattctgcaggagcccgtggtaaaggtagca
attattgatacaggcaagtacgaattttggctagcgatagaaggtaaagataatcgtctt
gggactcaggtcgccccaaatatcaatcctacctttgaattagctaccgatgcctttctt
ttcaactatacgctacaaaacattacattgtcttatatgttaaaatttaaggacttagat
aagtgtattcaattcaggtttgcttgggttaaatgtttatggatgactttgaacaaagaa
acgtggaccgacgttcctgaaaaggagaaagattatattttagattcatcatccgtgcca
ttggaaaagcaatttgatgacattttacacatagatgacagatcaaatgaggaaagagat
aaagaatcaagcgaaagtgaaaatgatagcgaagatgaggatgacgaaaacgatcactcc
aaaagaatcatttcatctgaagcctttgaagaacctaggcgtgcgacttccaaaggtaat
agttcattgactgtcgcctttaggaacaacaggtcatatgttacaagagataacagaatt
ggtgtgttcaaaacggatgatgaagacgattctctagaatttgtagctgccataaagaat
atttctaatttaggtggtaaaagcattgatcctcataagccaatgttgtatatggaagat
cgtaatttaattttgactgatggcgaaaatgagaacaaactttataagatggatatagaa
agaggaaaggtgattgaagaatggtctactggtgacaagaatgttgttcaatatggtcca
accaaaaaattcgatcaaatgacgcctgaacaaacaattgttggcgtttcacagaaaggt
gtctttaaaattgatcctagaattaacggaaaaaataaaatagccgtcgatgaatcaaaa
gattacgtgggtaaatataactttagctctattggaacaacagagagtggttatattgct
attgggtcagaaaaaggtgacataaaactatatgataggctcggtattagggcaaaaact
gctataccttcactaggccaagcaatcaagtttattactacctctgctgacggtaaatgg
ttattggcgacttgcgagagtactctgcttcttatggatttgaaaattaaggatggaaaa
aatgctggcaacattggatttctgaagtcgttcccagccagtgaaaatgttaaaacatat
gtattaaaaatacgaccagaacattcggcatcaatcttaacgtacacaaaaaaaccaatc
cgatttacgaaggcttattttaataccggtataggccagcaagaacaaactattgttaca
tcgacgggtccttatgcgatttcttggtcattaaagggcattttaaatcaagatggtagt
aataattatccttacagaatccgtaggtacaatgctgatgttgttgctgataattttgaa
tttggttcagacaaaaaggttatcgttgccttgaaagacgatgtctctctatcgaaagtg
aaatcctttaaacagccaagcaaaggagtcttgatgccaagtgcttccctccaagatttt
tatggctaa

DBGET integrated database retrieval system