KEGG   Saccharomyces cerevisiae (budding yeast): YNL215WHelp
Entry
YNL215W           CDS       T00005                                 

Gene name
IES2
Definition
(RefSeq) Ies2p
  KO
K11676  Ino eighty subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL215W (IES2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   INO80 complex (yeast)
    YNL215W (IES2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPA-1
Motif
Other DBs
NCBI-GeneID: 855506
NCBI-ProteinID: NP_014184
SGD: S000005159
UniProt: P40154
Position
XIV:244468..245430
Genome map
AA seq 320 aa AA seqDB search
MDSEASDIEAELSDSVSAGGEEYIDDDDYTEDIDDQIVTAKSSRRTARRSVPKGVRTSKR
IRDKELSVEVDEDYDEEEDVLSPSKKRHLHTRSMDKRQVAATASEKSDIGDSKGNDGEIE
DGILEEEESLEKELNRGGGKEVEKSEESYYAQNDVGQKGEEEQDGESGGYEDNEPSISKE
SDELVSVVNGNGNEEDDEVEATKENTTDSTRSTTTRSKMLLDLLEDGGSKKKLTDEEIQL
RRAENARKRKNLSEKRLEEEKQDTINKLLKKRAGKSRSHLPNDDEKNDGSSSFVKPRRPY
NSEGMTRILRRYEEDLFCTF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgaagcaagtgacattgaggcagagttatccgacagcgtctcagctggtggg
gaagaatacattgacgatgatgattatacggaagatattgacgatcagatagtcacagcc
aaatcatctagaagaacagcacgtaggagtgtacctaagggtgtaagaacctcaaaacgc
attagagataaagaactttctgtggaggttgatgaagattatgatgaggaggaagatgta
ttgagcccttctaagaagcgccatctacacaccagatcaatggacaaaaggcaagttgcc
gcaacagcttctgaaaaatctgatattggtgatagtaaaggtaatgatggcgaaatagaa
gacggtatattggaagaagaagagagcttagagaaggaactgaatagaggtggaggaaag
gaggtagagaaaagtgaagaatcttactacgcccaaaacgatgttggacagaagggggag
gaagaacaagacggggaatctggaggctatgaagataatgaacccagtataagtaaagag
tcagacgaattggtctctgtggtaaacggtaacggtaacgaagaggatgatgaagtggag
gcaacaaaagaaaatacaacagattctactagaagtactacgactcgaagcaagatgctg
ttagatttgctggaagatggtgggtctaaaaagaaattaacagatgaagaaatccagctg
cgaagagccgaaaatgcacgtaaaaggaagaaccttagcgagaagagactggaagaggag
aagcaggacacaatcaataagcttttgaagaaaagggccggtaagtctaggagccacttg
ccaaatgatgatgaaaagaatgatggctcttcaagtttcgtgaaaccacgcaggccttac
aatagcgagggtatgacaagaattctgcggagatatgaagaagacttattttgtacattt
taa

DBGET integrated database retrieval system