KEGG   Saccharomyces cerevisiae (budding yeast): YNL216WHelp
Entry
YNL216W           CDS       T00005                                 

Gene name
RAP1, GRF1, TBA1, TUF1
Definition
(RefSeq) DNA-binding transcription factor RAP1
  KO
K09426  Myb-like DNA-binding protein RAP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YNL216W (RAP1)
   03032 DNA replication proteins [BR:sce03032]
    YNL216W (RAP1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-like factors
    YNL216W (RAP1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    YNL216W (RAP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rap1-DNA-bind Rap1_C BRCT_2 Myb_DNA-binding Myb_DNA-bind_2 Myb_DNA-bind_6 BRCT SLIDE LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 855505
NCBI-ProteinID: NP_014183
SGD: S000005160
UniProt: P11938
Structure
PDB: 

Position
XIV:241689..244172
Genome map
AA seq 827 aa AA seqDB search
MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSE
KVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQ
VSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNH
TNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNK
DSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHND
LVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNK
ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYE
VDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSL
ITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENA
WRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRAR
NYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNS
LPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKL
HEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPP
PNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccagatgattttgaaactgcaccagcagaatatgttgatgcattggatccg
agtatggtcgttgttgacagtggttctgctgcagtcacagcgccatcggattcagccgct
gaggtaaaagctaatcaaaacgaagaaaacactggtgctactgctgctgaaactagtgag
aaagtggatcagacggaggtcgaaaagaaagatgatgatgataccactgaagtcggtgta
acaactaccacgccttccattgctgatactgctgctaccgctaacattgcttcgacatca
ggtgcatctgttactgaacctactactgatgacaccgctgctgatgagaaaaaggaacaa
gtaagtggtcctcctctgtcaaatatgaaattctatcttaatcgcgacgcggatgcgcat
gactctttaaatgatattgatcaattagcgcgtctgattagagcaaacggtggtgaagtg
ctagactccaagccaagagaatcaaaagagaatgttttcatcgtgtcaccctataatcat
accaatttaccaacggtaactccgacttatattaaggcatgttgtcaaagcaactcgcta
ctgaacatggaaaattatttagtaccatacgataactttagagaagttgtcgatagtagg
ttgcaggaggaatcgcattctaatggtgtagataatagcaatagcaatagcgataacaag
gattctatcaggcccaaaacagaaataatctctacgaatactaatggcgctacggaagac
tcaaccagcgaaaaagttatggtagacgctgaacaacaagctagattacaagagcaagct
cagctccttcgtcaacatgtaagcagcaccgcatcaatcacaagcggagggcacaatgac
ttggtccagatcgaacaacctcaaaaagatacctccaataataataatagcaacgtcaac
gacgaagacaatgatcttttgacacaggacaacaaccctcaaacagcagatgaggggaat
gcatcttttcaagcacaaaggtccatgatttcgagaggcgctttgccctcccacaataaa
gcttcttttacagatgaggaagatgagtttattttggatgttgtgagaaaaaatccaacc
aggcgtacaacacatactctttacgatgaaatatcccattatgtgcctaaccacacgggt
aattctattaggcaccgatttagagtctatctttccaaaagactagagtacgtttatgag
gttgacaagtttggtaaattggttagagacgacgatggaaatctgataaagactaaagtt
ttgccaccatcaattaaaaggaaattttcagcagatgaagattacactttggcaatcgcg
gtcaagaagcagttttatcgtgatttgtttcaaatcgaccctgatactggaagatcactt
atcacagatgaggatacacccactgctatagcgaggaggaatatgacaatggatccaaat
catgtgccagggagtgaacccaactttgcagcttacagaacccaaagccgtaggggaccg
attgcacgagaatttttcaagcattttgccgaagagcatgcagcacatactgagaatgct
tggagagataggtttaggaagtttcttctcgcttacggcattgatgattatattagttat
tatgaagctgaaaaagctcagaatagagagccggaaccgatgaagaacctcaccaataga
cccaagaggcctggcgttcccactcctggcaattataactctgccgccaagagggcaaga
aattatagttctcaaagaaatgttcagcctactgccaatgcagcgtccgctaatgctgct
gccgctgctgctgccgctgcttccaactcttacgctataccagaaaacgaattactggac
gaagataccatgaatttcatttccagtttaaagaatgatctatccaatatttcaaatagt
ttgccctttgagtatccacacgagattgcggaagctataagaagcgatttttcgaatgaa
gatatatatgataatattgatcctgataccataagctttccaccaaaaattgcaacaaca
gatcttttcctgccattgttctttcattttggcagtacgagacaatttatggataaactt
catgaagttatttcaggagattatgagccatcacaggctgaaaaactggtacaggatctt
tgcgatgaaactggtatacgtaaaaatttcagtacgagcatattgacgtgtttatccggg
gatctgatggtctttcctcgctatttcttgaacatgtttaaggacaatgttaatcctcct
cccaacgttcctggtatttggacacatgatgacgacgaatcgctaaaaagcaatgatcaa
gaacaaataaggaaactggttaaaaagcatggaactggtagaatggaaatgaggaaaaga
ttttttgagaaggacctgttatga

DBGET integrated database retrieval system