KEGG   Saccharomyces cerevisiae (budding yeast): YNL220WHelp
Entry
YNL220W           CDS       T00005                                 

Gene name
ADE12, BRA9
Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00250  Alanine, aspartate and glutamate metabolism
sce01100  Metabolic pathways
Module
sce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YNL220W (ADE12)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YNL220W (ADE12)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     YNL220W (ADE12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 855501
NCBI-ProteinID: NP_014179
SGD: S000005164
UniProt: P80210
Position
XIV:234413..235714
Genome map
AA seq 433 aa AA seqDB search
MVNVVLGSQWGDEGKGKLVDLLVGKYDIVARCAGGNNAGHTIVVDGVKYDFHMLPSGLVN
PNCQNLLGNGVVIHVPSFFKELETLEAKGLKNARSRLFVSSRAHLVFDFHQVTDKLRELE
LSGRSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVNDQPGAWEEFVARYKRLLETRRQ
RYGDFEYDFEAKLAEYKKLREQLKPFVVDSVVFMHNAIEAKKKILVEGANALMLDIDFGT
YPYVTSSNTGIGGVLTGLGIPPRTIDEIYGVVKAYTTRVGEGPFPTEQLNENGEKLQTIG
AEFGVTTGRKRRCGWLDLVVLKYSTLINGYTSLNITKLDVLDTFKEIPVGISYSIQGKKL
DLFPEDLNILGKVEVEYKVLPGWDQDITKITKYEDLPENAKKYLKYIEDFVGVPVEWVGT
GPARESMLHKEIK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgttgtattgggctcccaatggggtgatgagggtaaaggtaaactagttgat
ttactggttggtaaatatgatattgtagcccgttgcgccggtggtaacaatgccgggcat
accattgttgtagacggtgttaagtatgatttccatatgttaccatctggtttagtcaac
ccaaactgccaaaaccttttgggtaatggtgttgttattcatgttccatcttttttcaaa
gagttggaaaccttggaagctaaaggtttgaagaacgcaaggagtagattatttgtttct
tccagagcacatttagtctttgactttcatcaggtgactgacaagctaagagaattggag
ttatcaggtcgttctaaagatggtaaaaatatcggtactaccggtaaaggtattggtcca
acttattccacaaaggcttctagatctggtttgagagttcatcatttggtgaatgatcaa
cccggtgcctgggaggaatttgttgctagatataagagattattggaaacgagaagacaa
agatacggtgatttcgaatacgactttgaagccaagcttgctgaatacaagaagttaaga
gagcaactaaagccattcgtcgtcgattctgtcgttttcatgcacaatgctattgaagca
aagaaaaagatattggttgagggtgctaatgctttgatgttggatattgattttggtact
tatccatatgtgacttcttccaatactggtattggtggtgtcctcaccggtttaggtatt
cctccacgtactattgatgaaatttatggtgttgttaaagcctacacaactagagttggt
gaaggtcctttcccaacggaacaattgaacgaaaatggagaaaaactgcagaccattggt
gctgaatttggtgtcactactggtcgtaagcgtcgttgcggttggttagacttggtagtc
ttgaaatactcaactttgatcaatggatacacgagtttgaacattaccaagttagacgtc
ctcgatactttcaaagaaatcccagtgggtatttcatattctattcaaggtaagaagcta
gatttgttccctgaagacttgaatattcttggtaaagttgaagttgaatacaaagttttg
ccaggttgggatcaagatattaccaaaattacaaagtatgaagatttgccggaaaacgca
aagaagtacttaaaatatattgaagattttgttggcgttcctgttgaatgggttggtacc
ggccccgcaagagaaagcatgttgcataaagaaattaaatag

DBGET integrated database retrieval system