KEGG   Saccharomyces cerevisiae (budding yeast): YNL221CHelp
Entry
YNL221C           CDS       T00005                                 

Gene name
POP1
Definition
(RefSeq) ribonuclease P/MRP protein subunit POP1
  KO
K01164  ribonuclease P/MRP protein subunit POP1 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YNL221C (POP1)
   03008 Ribosome biogenesis in eukaryotes
    YNL221C (POP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YNL221C (POP1)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YNL221C (POP1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL221C (POP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YNL221C (POP1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     YNL221C (POP1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    YNL221C (POP1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YNL221C (POP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POP1 POPLD GCV_T_C
Motif
Other DBs
NCBI-GeneID: 855500
NCBI-ProteinID: NP_014178
SGD: S000005165
UniProt: P41812
Structure
PDB: 

Position
XIV:complement(231068..233695)
Genome map
AA seq 875 aa AA seqDB search
MSGSLSRGNGGKKVLNKNQLLKRNRIRNARSIRAEAVAASSTKTGTPSDLSESGSKLNVD
QFISSRQFEVKQLQLAMHNSKAASSTRIFQALPRKLRRRTASHNVRRIPKRMRNRALREM
RKSDQQDVLKGSSASSRKAHGLNAKQLYKARMSIKLLRLASKSTSMKLSMPPEVTSSNCH
VRQKIKTLKRMIKESSTANPNIKLLNNRMGSYDCTGVNELAPIPKGRVKYTKRQKHFAWL
PTHIWNAKRSHMMKRWGYQMVWAPTQKCFKLTHRLGGDTCSSDGALCMDSSYIGTIIVKD
KSNDSEGDFLKSIIGKLTAERANLRKYREGQVLFQGLIYSFNEENGEDSTKPLGPCDVFW
VQKDTAIIRLHPSIYTQVFNILLQHKEKLTVQDCRYSLASVTLKGAKALESLASCLRSTE
YSKSFEQFKMVSMITDHNALPQRCTFAFEAIDPRHLAAPKKLNDSQRKTVNSDDILSLHE
NYPQDEINAVFNELCDPESRTQSYNNQNTLKEISARRYKLLTATPNSINKTTVPFKESDD
PSIPLVIIRRLKTRDWIVVLPWFWLLPLWHLLNRIPRMYHIGLRQFQQIQYENKQLYFPD
DYPFTQLGYIENSFYKKEASKTKWDRKPMGKRINFEKIKDIHNTKLPAYSGEIGDFFSSD
WRFLQILRNGIDYLQRNDKTLELMDSKKTGQFNAQGVRDINCVNDVLEFCKDYEAKTKAM
SLSIEENIPVALCKNRKCQFRTPDSISVNSSSFSLTFFPRCIIAVSCTLLERGHPKDNAR
IYQVPEKDLEHWLQLAKGVYRPNGRKDHDLKIPLPEVHDLIGFITSGTYHLNCGNGMGIG
FIDHHAAIRQPTRYVLIRNVGTNTYRLGEWSKISV
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggagtttgtctagaggaaatggtggaaagaaagttcttaataagaatcaatta
ctgaagcgaaatcgcataagaaatgctagatcaattagagcagaggccgtggccgcttca
tcaacaaaaactgggacaccgagtgatctgagtgaatcgggaagtaagctaaacgtggac
caattcattagttctcgacaattcgaggttaagcagttgcaattggccatgcataattcc
aaagcagccagctcaacgagaatatttcaggcattgcctcgaaaattgcgtcgtagaacg
gcttcgcataatgttcgtagaattccaaaaagaatgcgcaatagagctttgagggaaatg
cgtaaaagtgatcagcaggatgtgttgaaggggtcttcagcctcttccagaaaagctcat
ggcctaaatgcaaagcaactttataaagctagaatgtccataaagctgctacgattggct
agcaaatctacttctatgaaactcagcatgccaccagaggttacatcatctaactgccac
gtaaggcagaaaatcaagacattaaagcgaatgattaaagaatcatcaacagcaaatcca
aatataaagttacttaataatcgtatggggagctatgattgcactggtgtcaatgaatta
gcacctattcccaagggcagggtcaaatatacgaagagacagaagcactttgcttggcta
cccacccacatttggaatgctaaaaggtcgcacatgatgaaaagatggggatatcaaatg
gtatgggcacctactcaaaaatgctttaaattgacgcataggttgggcggtgatacctgc
agctccgatggggccttatgcatggattcaagttatattggtacaataattgtaaaagac
aaaagcaatgacagtgagggggactttttaaaatccattataggaaagttaacagctgaa
agagcaaacttaaggaaatatcgcgaaggccaggttttattccaagggttaatttatagt
ttcaatgaagaaaacggtgaggattctactaagccactgggtccatgcgacgtattttgg
gtacaaaaggatactgcaattataaggttacacccttcaatttatactcaggtttttaac
attcttttgcaacataaggaaaaactaacagtacaagattgtcgatattcattagcaagc
gtgacattgaagggagctaaagctctagagtcattagcatcgtgtttaaggagcacagag
tactctaaatcgtttgaacaatttaaaatggtttcaatgattaccgatcataatgcccta
ccacagaggtgtacgtttgcatttgaagccatagatccgcgtcatctagctgctccaaag
aaattaaatgattcacagaggaagactgttaattctgacgacattttatcactgcatgaa
aactatcctcaagacgaaataaacgccgtttttaacgaattatgtgaccctgaatcacgt
actcaatcatacaacaaccaaaacacattaaaagaaatttctgcgagacgttacaaattg
ctaactgccacaccgaacagcatcaataaaactacagtcccgttcaaagaaagtgacgat
ccttctattccattagtcataataagaaggctcaagaccagggattggattgttgtgtta
ccatggttctggctgctaccgttatggcatctactgaaccggataccaaggatgtatcac
attggcctcaggcaattccagcaaattcagtacgagaataagcaattatattttccggat
gattatccattcactcaattgggttatatagaaaactcattttataaaaaggaggcctcc
aagacgaagtgggataggaagccaatgggaaaaaggattaatttcgagaagatcaaagac
atccataacactaaattaccggcatatagcggagaaatcggcgattttttcagttcagac
tggagatttttacaaatactgagaaatggaattgattatttacagcggaatgataaaacc
ttagaactgatggacagtaagaagaccgggcaatttaacgctcagggtgtaagagacatc
aactgtgtaaatgatgttttggagttttgcaaagattatgaagccaagaccaaggctatg
tcgttgtcgattgaagagaacataccagttgcattgtgtaaaaatcggaaatgtcaattt
cgcactcctgatagcattagcgtcaatagttcttcattctcccttacattcttcccacgt
tgtatcattgctgtatcttgcacactactcgaacgaggtcacccaaaggacaatgcaaga
atatatcaagttccagaaaaggacttagagcattggctacaattggcaaaaggggtttac
cgcccaaacggaagaaaagatcatgatttgaaaattccacttccagaggtacatgatttg
attggttttattaccagcggcacctaccacttaaattgtggaaatggtatgggaatcgga
tttatagatcatcatgcggccatccggcaaccaactaggtatgtactgatcagaaatgta
ggtaccaacacttataggttgggggagtggtcgaaaatatccgtataa

DBGET integrated database retrieval system