KEGG   Saccharomyces cerevisiae (budding yeast): YNL222WHelp
Entry
YNL222W           CDS       T00005                                 

Gene name
SSU72
Definition
(RefSeq) RNA polymerase II subunit A C-terminal domain phosphatase
  KO
K15544  RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YNL222W (SSU72)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YNL222W (SSU72)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YNL222W (SSU72)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YNL222W (SSU72)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YNL222W (SSU72)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YNL222W (SSU72)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ssu72
Motif
Other DBs
NCBI-GeneID: 855499
NCBI-ProteinID: NP_014177
SGD: S000005166
UniProt: P53538
Position
XIV:229094..229714
Genome map
AA seq 206 aa AA seqDB search
MPSHRNSNLKFCTVCASNNNRSMESHKVLQEAGYNVSSYGTGSAVRLPGLSIDKPNVYSF
GTPYNDIYNDLLSQSADRYKSNGLLQMLDRNRRLKKAPEKWQESTKVFDFVFTCEERCFD
AVCEDLMNRGGKLNKIVHVINVDIKDDDENAKIGSKAILELADMLNDKIEQCEKDDIPFE
DCIMDILTEWQSSHSQLPSLYAPSYY
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtcatcgcaattcaaacttgaagttttgcacagtttgtgcatcaaacaacaat
cgttcaatggaatcgcataaagtcctgcaagaagcaggctataatgttagctcttacgga
acaggttcagctgtgagactgcctggtctatcgatagataagcctaatgtgtactcattt
ggtacaccctataatgatatatataatgatcttttatcacaatcagcagaccgttacaag
tcgaacggtttattgcaaatgctggatcgtaatagaagactcaaaaaagcacctgaaaaa
tggcaagaaagtacaaaagtcttcgacttcgttttcacttgtgaagagagatgttttgat
gccgtttgtgaagatttgatgaatagaggtgggaaattaaacaaaatagtgcatgtaatt
aatgttgacattaaagatgatgatgaaaatgctaaaattggtagcaaagctatattggaa
ttagctgatatgctcaatgataaaatagaacaatgtgaaaaagatgacattccctttgaa
gattgtataatggacattttaactgagtggcaaagctcacattctcaactaccgtcatta
tacgctccttcatattactaa

DBGET integrated database retrieval system