KEGG   Saccharomyces cerevisiae (budding yeast): YNL223W
Entry
YNL223W           CDS       T00005                                 

Gene name
ATG4, APG4, AUT2
Definition
(RefSeq) cysteine protease ATG4
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YNL223W (ATG4)
   04136 Autophagy - other
    YNL223W (ATG4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YNL223W (ATG4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL223W (ATG4)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL223W (ATG4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     YNL223W (ATG4)
Peptidases and inhibitors [BR:sce01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   YNL223W (ATG4)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    YNL223W (ATG4)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    YNL223W (ATG4)
SSDB
Motif
Pfam: Peptidase_C54
Other DBs
NCBI-GeneID: 855498
NCBI-ProteinID: NP_014176
SGD: S000005167
UniProt: P53867
Position
XIV:227370..228854
AA seq 494 aa
MQRWLQLWKMDLVQKVSHGVFEGSSEEPAALMNHDYIVLGEVYPERDEESGAEQCEQDCR
YRGEAVSDGFLSSLFGREISSYTKEFLLDVQSRVNFTYRTRFVPIARAPDGPSPLSLNLL
VRTNPISTIEDYIANPDCFNTDIGWGCMIRTGQSLLGNALQILHLGRDFRVNGNESLERE
SKFVNWFNDTPEAPFSLHNFVSAGTELSDKRPGEWFGPAATARSIQSLIYGFPECGIDDC
IVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILSSTQSVGIA
GGRPSSSLYFFGYQGNEFLHFDPHIPQPAVEDSFVESCHTSKFGKLQLSEMDPSMLIGIL
IKGEKDWQQWKLEVAESAIINVLAKRMDDFDVSCSMDDVESVSSNSMKKDASNNENLGVL
EGDYVDIGAIFPHTTNTEDVDEYDCFQDIHCKKQKIVVMGNTHTVNANLTDYEVEGVLVE
KETVGIHSPIDEKC
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcagaggtggctacaactgtggaaaatggatttggtacaaaaagtgtctcatggcgtt
tttgaaggctcgtccgaagaaccggctgctcttatgaatcatgattatatagtattaggg
gaagtatatcctgagcgagacgaagaatctggcgctgaacaatgtgaacaagactgtcga
tatcgcggtgaagcggttagtgacgggtttttaagctctctttttggtagggaaatttct
tcttacacaaaggaatttcttttggatgtacaatcaagggtcaactttacatatcggaca
agatttgttcctatagcaagggcgccagatgggccttcacctttaagtctaaatttatta
gtacgtacaaatccgatcagtacaatagaggactatatagcaaatcctgattgctttaac
actgatattgggtgggggtgtatgataaggacaggacaaagtttgttggggaatgcctta
caaatccttcatttgggcagagatttcagggtaaatggtaacgaaagtctggaaagagaa
tcaaaatttgtaaattggtttaatgacacgcctgaggctccattttcgttacataacttt
gtttctgcaggtacagaactctctgataaaagaccaggtgaatggtttggtcccgcagct
acggcaaggagtatacaatctttaatatatggcttccccgaatgtggcatcgatgattgt
atagtatctgtttcatccggcgatatctatgaaaatgaagttgaaaaagtatttgctgag
aatccaaatagtagaatattgttcttgttgggcgtgaagctcgggattaatgcggtaaat
gagagctatagagaaagtatatgtggtatcttaagttcaacacagtcagtaggcattgcc
ggcggtaggccgtcttcatcgttgtatttttttggttatcaaggaaatgaatttttacat
ttcgatcctcatattcctcaaccggcagtagaagattcatttgtagagtcgtgccatacc
agtaaatttggtaaattgcaactatcggaaatggatccctcgatgctcattggtattttg
attaagggcgaaaaagactggcaacaatggaagctagaagttgcagaatctgctattatc
aatgttcttgctaagagaatggatgactttgatgtgagttgtagtatggatgacgtggaa
agtgtaagttctaactcaatgaagaaagatgcaagcaataatgaaaatctcggagtacta
gagggagactacgtagatattggtgcaatattcccacacacaacaaatacagaagatgta
gacgaatatgattgttttcaagatattcattgcaagaaacagaagattgttgttatggga
aacacacacactgttaatgcgaatttaacagattatgaagtagaaggcgtccttgtagag
aaggaaacggtaggtattcacagtcctattgatgaaaaatgctag

DBGET integrated database retrieval system