KEGG   Saccharomyces cerevisiae (budding yeast): YNL224CHelp
Entry
YNL224C           CDS       T00005                                 

Gene name
SQS1, PFA1
Definition
(RefSeq) Sqs1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G-patch R3H G-patch_2 LPD1
Motif
Other DBs
NCBI-GeneID: 855497
NCBI-ProteinID: NP_014175
SGD: S000005168
UniProt: P53866
Position
XIV:complement(224796..227099)
Genome map
AA seq 767 aa AA seqDB search
MAKRHSHYQGSRRRHARGSNSKKAGRGNAKGIQGRKIKKKPTPTNSWHNSSIPLGEGDLD
DVGADFNPGRAFISPKTIEDYYFGRDAKSRSMKMGGLRPGNRYDSSTDLQAGRAAFRKRP
MQFVKAKEVYDPSHNMIQKLRAKNETKNSEEIVEREADVFEEPGKMTSDVEYINNEDSEN
EDDDSQNSPSTDHSLSSNESKVEDGDLFFVDEEAQQSPDLTKIKRVCIEEIARPREVAIE
FDPILTIGKVELSVSEGNESKEISVDVPNKGNKTYHPFAGYISNVLHGMHTSDSDNDELD
YEIETENNSEPLYESSASSEVDQGFNYVGQRHNSRADNNLLPSPSPQLTEDIKCLSINGT
KTFEGNNDNLPSPASEELEFGFKEEDFVINTNDIVVSNIRMGGVDNSYYLRCYRLLGDYD
FHWIDQDLLTDFVVDELGLPEDRLPAYLNFIKNSLIPKIEPAEPTYSDIPISDSSDEGDS
YEGDSYEDDEDMASSVVHSDIEEGLDDLIAYTLKHDTERFKTFETKSLETKGKGKKKKLL
IDDALALDTETLETLQSKFSKRIETKAKKRKAKEDFIDQENRNSNDMLKKYPYGLHIQNI
KDEFESFLSRNNDRLTFPPLDPHGNKTVMKIAKHYNMKSSKIGKANHTSVVVEKIKKTKW
SSPNYSLIDQLMRQRPVFMRIDIRRPREEQAAFERTKTIRGKFHVKEGEIVGQNAPEIGN
ENIGRRMLEKLGWKSGEGLGIQGNKGISEPIFAKIKKNRSGLRHSES
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaggcatagtcattatcaaggaagcagacgtaggcatgcacgtggtagcaat
tccaagaaagctggcagggggaatgctaaaggcatacaaggcagaaagataaagaaaaaa
cctactcccactaacagttggcataactcttctataccactaggagaaggtgatcttgat
gatgtaggcgccgacttcaacccaggaagagcattcatatcaccaaaaactatagaagac
tattattttggtcgcgatgccaagagccgttctatgaaaatgggtggtttaagaccaggt
aatcgatatgattcttcaactgacctacaagcaggaagggcagcattccgcaaaagacct
atgcaatttgtaaaagctaaggaagtttacgatccatcccacaatatgattcaaaaactg
agagcaaagaacgaaacaaagaacagtgaagaaattgtcgaaagggaagcagacgttttt
gaagaaccaggaaagatgacttctgatgttgaatatattaacaatgaagacagtgaaaac
gaggatgatgatagtcagaattcaccctcgacggaccactcgctgtcttcgaatgaaagc
aaagttgaagatggtgacctgttttttgtagatgaagaggctcagcaatcgccggatcta
accaaaataaaaagagtatgtatcgaggaaatcgcaaggccaagagaagttgcgatagag
ttcgatcctatcttaacaattggaaaggttgaacttagcgtttccgaaggtaacgaaagc
aaggaaattagtgttgacgttccaaataagggtaataagacatatcatccatttgctggt
tacatttccaacgtattacatggtatgcatactagcgactcggacaatgatgaactagac
tacgaaatagaaacagagaataatagtgaacctttatacgaatcctcagcaagttctgag
gttgatcaagggtttaattatgttggccaacgtcacaattcccgagctgacaacaatctt
ttaccaagccctagtccgcagttgacagaagatataaaatgtctttcaataaatggtacc
aaaacattcgaaggcaataatgataatctgccatctcctgctagcgaagagttagaattt
ggattcaaagaagaagattttgtcataaatactaatgacatagtggtctccaatataaga
atgggcggagtagacaattcatattatctacggtgttacagattactgggagattacgac
tttcattggattgaccaggacttactcacagacttcgttgtagacgagttaggtcttcct
gaagatagattacctgcatatttgaattttattaaaaattctcttataccaaaaattgaa
ccagctgagccaacctactcagatattccgatttctgattcgagtgatgaaggtgacagc
tatgaaggcgacagctatgaagatgatgaagatatggcctcctcggttgtgcatagcgac
attgaagagggtctggacgacctaattgcatacacattgaaacatgatacagaaagattc
aaaacatttgaaaccaagtccttggaaactaagggtaaaggtaagaagaagaagctactc
atcgatgacgccttagcgctggatacagaaacgttggagacgttacaaagtaagtttagt
aaacgcatagaaaccaaagcaaagaaaagaaaagccaaagaagatttcattgatcaggag
aatagaaattcgaacgatatgctcaagaaatacccatatggactccatattcaaaatatt
aaagatgaatttgagtcctttttgtctaggaacaatgatagactgactttccctccatta
gatcctcatggaaacaagaccgtaatgaaaattgcgaagcattataatatgaagagttca
aaaattgggaaagcaaatcatacgtcggttgttgtagaaaaaataaagaaaacgaaatgg
tcttctccgaattatagtctcattgaccaattgatgaggcagaggccagtattcatgaga
atagatataagaagaccgagggaggaacaagctgctttcgaaagaactaaaacaatcaga
gggaaatttcatgttaaagaaggtgagattgttggtcaaaacgctccagagattggaaac
gaaaatatcggtagaagaatgttggaaaagcttgggtggaaaagtggagagggccttggt
attcaaggcaataaaggtataagtgaaccaatttttgccaaaattaaaaagaatagatcg
ggtttaagacacagtgaaagttaa

DBGET integrated database retrieval system