KEGG   Saccharomyces cerevisiae (budding yeast): YNL227CHelp
Entry
YNL227C           CDS       T00005                                 

Gene name
JJJ1
Definition
(RefSeq) Jjj1p
  KO
K09506  DnaJ homolog subfamily A member 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YNL227C (JJJ1)
   03110 Chaperones and folding catalysts [BR:sce03110]
    YNL227C (JJJ1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YNL227C (JJJ1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP40 / DNAJ
   YNL227C (JJJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ zf-C2H2_jaz zf-C2H2_4 zf-C2H2 zf-met zf-C2H2_2 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 855495
NCBI-ProteinID: NP_014172
SGD: S000005171
UniProt: P53863
Position
XIV:complement(220659..222431)
Genome map
AA seq 590 aa AA seqDB search
MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDP
QERAWYDSHKEQILNDTPPSTDDYYDYEVDATVTGVTTDELLLFFNSALYTKIDNSAAGI
YQIAGKIFAKLAKDEILSGKRLGKFSEYQDDVFEQDINSIGYLKACDNFINKTDKLLYPL
FGYSPTDYEYLKHFYKTWSAFNTLKSFSWKDEYMYSKNYDRRTKREVNRRNEKARQQARN
EYNKTVKRFVVFIKKLDKRMKEGAKIAEEQRKLKEQQRKNELNNRRKFGNDNNDEEKFHL
QSWQTVKEENWDELEKVYDNFGEFENSKNDKEGEVLIYECFICNKTFKSEKQLKNHINTK
LHKKNMEEIRKEMEEENITLGLDNLSDLEKFDSADESVKEKEDIDLQALQAELAEIERKL
AESSSEDESEDDNLNIEMDIEVEDVSSDENVHVNTKNKKKRKKKKKAKVDTETEESESFD
DTKDKRSNELDDLLASLGDKGLQTDDDEDWSTKAKKKKGKQPKKNSKSTKSTPSLSTLPS
SMSPTSAIEVCTTCGESFDSRNKLFNHVKIAGHAAVKNVVKRKKVKTKRI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctgctactatgagcttttaggggtcgaaacgcatgcttctgatcttgagtta
aaaaaagcttaccgtaaaaaggccctacaatatcacccagataaaaacccagataatgtt
gaagaagccacacaaaaatttgctgtgattcgagccgcttatgaagtactgtctgacccc
caggaaagagcatggtatgactcacataaggaacaaattttaaatgatactccaccaagc
actgatgattactatgattatgaggtagacgctacagtcacaggtgtcacaactgatgaa
ttactcttattttttaactctgctctttatactaaaatagacaactcagctgctgggata
tatcaaattgcaggaaaaatatttgccaagttagctaaagatgagattttaagtggtaag
cgactggggaaattttccgagtatcaagatgatgtattcgaacaggatattaatagtatt
ggctatttgaaagcctgcgataactttattaacaagacggataaacttttatatccttta
tttggatattcgccaacggattatgaatatttgaaacatttctataagacttggtcagcg
ttcaataccttgaaaagttttagctggaaagacgagtacatgtactctaaaaactatgac
agaagaaccaagagggaagttaatagaagaaatgagaaggctaggcaacaagctcgaaat
gaatacaacaaaaccgtgaaaaggtttgtagttttcataaaaaagctcgataaaagaatg
aaagaaggtgcaaaaattgcagaagaacagcgtaaactaaaagaacaacagaggaaaaat
gagttaaataacagaagaaagtttgggaacgacaacaatgacgaagaaaaatttcattta
caaagctggcaaacggtaaaagaagaaaactgggatgaactggaaaaggtatatgataat
tttggagaattcgaaaattctaagaatgataaggaaggtgaagtattgatttacgagtgt
tttatctgcaacaagacatttaagtcggaaaagcaattgaaaaaccacataaacactaaa
ctgcataagaaaaatatggaagagatacggaaagaaatggaagaggaaaacataacgctt
gggttggataatctctccgatctcgagaaatttgattcagcagatgaaagtgttaaagaa
aaagaagatattgatctgcaagcattgcaagctgaactcgctgaaattgaaagaaaactg
gcagaatcgtcttctgaagacgaaagtgaagatgacaatctcaacatagaaatggatata
gaggtagaagacgtcagttcggatgaaaatgtacatgtgaatacgaagaataaaaagaaa
agaaaaaagaaaaaaaaagcaaaggttgacacagaaacagaggaatctgaatcgttcgat
gatactaaagacaaacggagtaatgagttggatgatcttttggcatcactaggagacaag
ggcttacaaacggatgacgatgaagattggtctactaaagcgaaaaagaaaaagggcaaa
caacctaaaaagaattctaaatccacaaaaagcactccgtccttgtcgactctaccgtcc
tctatgtctccaacctccgcgatcgaggtgtgcactacatgcggagaatcatttgatagt
cgaaataagctattcaaccacgtgaagatagcagggcatgcggcagtgaaaaacgtagtg
aaaagaaagaaagtcaagaccaaaagaatatag

DBGET integrated database retrieval system