KEGG   Saccharomyces cerevisiae (budding yeast): YNL270C
Entry
YNL270C           CDS       T00005                                 

Symbol
ALP1, APL1
Name
(RefSeq) arginine permease ALP1
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL270C (ALP1)
Transporters [BR:sce02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YNL270C (ALP1)
SSDB
Motif
Pfam: AA_permease AA_permease_2 KH_5
Other DBs
NCBI-GeneID: 855451
NCBI-ProteinID: NP_014129
SGD: S000005214
UniProt: P38971
Position
XIV:complement(135940..137661)
AA seq 573 aa
MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSP
QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ
SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEA
VPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGP
IGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL
PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDI
FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLA
FLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPF
LAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQ
DIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggatgaaactgtgaacatacaaatgtccaaggaaggtcagtatgaaatcaattctagc
tctataataaaagaggaggagtttgtagatgaacaatattctggggagaacgttacgaag
gccatcaccacagagagaaaagtcgaggatgatgctgctaaggaaacagagagctcacca
caagaaagaagagaggtgaagcggaagttaaagcagcggcatatagggatgattgctctc
ggcggcaccattgggacgggcctcataattggtattggtccgccattggcacacgccggc
cctgttggtgccttgatatcgtatttatttatggggacagtgatttactccgttacacaa
tcgttaggagagatggtcacttttatcccggttacatcttcattttctgtcttcgcccaa
agatttctgtcgccagcgctgggagcgactaacggatatatgtactggctgtcgtggtgt
ttcaccttcgcactggaactatccgttttggggaaagttattcagtactggacagaagca
gtgcctctagcggcttggatcgtgatcttttggtgcctgttaacttcaatgaacatgttt
cccgtaaagtattacggagaatttgagttttgtattgcctccataaaggtcatcgcgttg
ctcggttttatcattttctcattctgtgttgtgtgtggtgcgggacaatctgatggaccc
atcggtttcaggtactggagaaatccaggagcctgggggcctggcattatctccagtgat
aaaaatgagggccgttttctcggatgggtttcctctttgattaatgctgcatttacgtac
caaggtactgaactggttgggataaccgctggtgaagcggctaacccaagaaaagctctc
ccgagggcaataaagaaagttgtagtgaggattctagtcttttacattctttcactattt
ttcattggccttttggtcccatataatgacccaaagttggatagtgacggtatatttgtc
tcttcatcgccctttatgataagcattgagaattcaggcacaaaagttctcccagatata
tttaacgcggtcgtgctaatcaccattctttccgcaggtaactctaatgtgtacattggc
tcaagagtactgtatagtctgtctaaaaatagcttggcgccaaggttcttgtctaacgtg
accagaggtggtgttccatacttttctgttctatctacatccgtgttcggatttttggct
ttcttagaggtttctgcaggcagcggcaaggcctttaactggttattgaacataactggt
gtggccggtttctttgcctggcttttgatttcattttctcatatccgtttcatgcaagcc
ataaggaaacgtggtatatcgagggatgacttaccttataaagctcaaatgatgcctttt
ttggcatattatgcatcttttttcatcgctctaattgttctgatccagggcttcaccgct
ttcgcacctacttttcagcctatagactttgtcgctgcatatatatcaatattcctattt
ttggccatatggttatcattccaagtttggtttaagtgccgcttactctggaagctgcag
gatatcgatatcgattctgaccgccggcaaatagaggagttggtatggatagagccagaa
tgtaaaacaaggtggcaacgagtttgggatgtcctttcataa

DBGET integrated database retrieval system