KEGG   Saccharomyces cerevisiae (budding yeast): YNL273W
Entry
YNL273W           CDS       T00005                                 
Symbol
TOF1
Name
(RefSeq) Tof1p
  KO
K10997  replication fork protection complex subunit TIMELESS/Tof1/Swi1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL273W (TOF1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL273W (TOF1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Fork protection complex
    YNL273W (TOF1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   FPC (fork protection complex)
    YNL273W (TOF1)
SSDB
Motif
Pfam: TIMELESS Phage_int_SAM_5
Other DBs
NCBI-GeneID: 855448
NCBI-ProteinID: NP_014126
SGD: S000005217
UniProt: P53840
Structure
Position
XIV:122883..126599
AA seq 1238 aa
MSADLQQGTTNAADFSLTVLRARIALLATAIGGPDYTSQIDPPPYKLGDDCLACLKDLKR
WFKLVDDQQKRWDVAMAVAEYRILTDDLLPILIDWENKCSLAAKLAKNNPDHEEFRNKAY
YDKIALNCLQLLVLMTWPLIVTEQSSSNQITLYGELKKHQLVYKKTILSMESGKVLRAAI
RLALDVIKIDRLSRTPRDNMVLKLVLNFFRNVIAIEPGEFTINTKKSMPKKGITSIDTLP
PNVSMDDISLNTVISSFHKNKVFGFLLTLTSSLSKEFDQDFINIPLLEIMFYFTKDVNQE
LLFPRQFETGTHSKVVNKNESSSANNIVTSAGFELSKLLQKEHQMRKNVIKHTSARHSRF
GGLLSIQTPDKTRLTVSGSQALVDEKIALQKLDDSKKWNKRIIKKHQSVAAEGLPNSLLN
SQTGKAIFFTESNGKHFKEFINNFIDSGFNILLHSVTNYFTTEQDRMVTLEQVEYLLFFA
WFVKYQLLRSKIDNSADIKQVSEALKEVTFILVSSLLRSAYDLKNWTVTHAGMIAFNELL
NLVSRTKAAQEEDSTDIEFIVSRLFSDERIQLLSNLPKIGSKYSLQFMKSCIELTHSVLK
VLEQYSDDKTLVIEGKSRRQKKFNISEGDITKLIEEENVDRDEALDILTSSLRSIEVNFQ
KVQANYMTEPVIETYINFLERFRELEDDSIKKVFSFFHRVFVQAKEQALLFRFDLIILLR
EMLSPDGLDRMSRSRKYVSQFSDYFLARLKKRLKKSPAWFVGLLFPPLHNSEVGFYQRYG
EYNVLNNESMYAAPASQFKPIPDEEALPPSILLDMKYGVLVSTLLDDGKTELLDQLLKHI
THTLDIFKSWLTVNVNAGKETVNPPNEYFTLTGVLNNDPIFKDKDYRALLLLIGYSIPRK
INEPCFLPGTVEVSDLTVSCELVKKYLSTPFETPNGLPSSSYLLRVRSEKDSFSHNEQDG
WEGDDDYDYNDPYIVPDDQILSKSDAAYFKDLDNNASDKLKGTKFSKGIARSKKKDKRKR
RKGEAKTNLPMFGDQDDERPQTVRERHGVFSKEFISDSEDDEDLMNPIFFENETYMRWLL
DKNNGQLTEDRYIQFAKFAAERMNNGGVVTGDYTSLFGGSIPSIESIRATESSSFAPDKS
LISLASHVASEMSIFDVNNNNNNQLSDDDVNSESRNSLGSSQPSNSQNMFQSEVYSRKES
TKRSLEASAADESDEDEEAIRLFGKKSRVVLSQGDSDD
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgtctgctgatttgcaacaaggcactacaaatgcggctgatttctctctgacggtactt
agagcaagaattgctttattggcaactgccatcggtgggccggattatacttcccagata
gacccacccccttataagcttggcgatgactgtttggcgtgcttaaaagatctgaaaaga
tggtttaaactagtggatgaccagcagaaaagatgggatgtggcaatggcagtagctgaa
tatcgcatcttgacggatgatctgttacctattctgatagattgggaaaacaaatgttct
cttgcagcaaagcttgcaaagaacaacccagaccatgaagagtttagaaacaaagcttat
tacgataaaattgcgctaaattgtctacaactattggtccttatgacttggcctttaatt
gtaactgaacagtcttcatcaaatcaaattactctctatggtgagctaaagaagcatcaa
ttggtatacaagaaaacgattctgtctatggaaagtggtaaagtgttaagagctgccatt
agattggctctggatgttatcaaaatcgaccgattatcaagaactcctagggacaatatg
gttctcaaattggttttgaattttttcagaaatgtcattgctatagaacccggtgaattt
actatcaatactaagaaaagcatgcctaagaaaggtatcacatctatcgatactttgcca
ccaaacgtctctatggatgacatctctttaaatacggttatttcctcattccataaaaac
aaggtattcggtttcctcttaacgctgaccagctccttatcaaaagagtttgaccaggac
tttatcaatatcccactgttggagattatgttctacttcactaaagatgttaaccaagaa
ctgctattccctcgacagttcgaaaccgggacacattcaaaggtggtaaataaaaatgag
agctcctctgctaataacattgttacaagtgcaggttttgaactatcgaagttattacaa
aaggaacaccaaatgagaaaaaacgttatcaagcatacatctgcaagacactccagattt
ggtggtcttttatctatacaaacaccagataaaactaggttaactgtttctggtagccaa
gctctcgtagatgaaaaaatagcgctccaaaaactagatgacagcaaaaaatggaataaa
agaataattaaaaagcatcaatctgtcgcagctgagggcttaccgaatagtctcttgaat
tcacaaaccggtaaagctatttttttcaccgaatcaaatggtaaacatttcaaagaattc
atcaacaactttatagattccggctttaacatcttgttgcatagtgtgacgaactacttc
acaactgagcaggataggatggtaactttggagcaagtcgaatatttacttttctttgca
tggtttgttaaataccagttgttgaggtccaaaatcgacaattccgcagatataaagcaa
gtttcagaagccttgaaagaggtgactttcattctagtgtcttctcttttaagaagcgca
tatgacctgaaaaattggacagtgacacatgctggtatgattgcatttaatgaactgttg
aacctcgtttcccgtacaaaggccgctcaagaagaggattcgaccgatatagaattcatt
gtaagtaggcttttcagtgacgagagaatacaattactgtcaaatctgccgaagattggt
tccaaatactccctccaattcatgaaaagttgcattgaactaacacactcggtattgaaa
gtattagagcaatactctgacgataaaacattagttattgaaggcaaatcaagacggcaa
aaaaagtttaatatttcagaaggtgatattactaaattgatagaagaagaaaatgtagat
agagatgaagcgcttgatattctaacctcttctttaagaagtatagaagtcaattttcaa
aaggtgcaagccaactatatgacagaaccggtaatagaaacgtacattaatttccttgaa
agatttcgtgagcttgaggacgattccattaaaaaagtattttcctttttccatagagta
tttgttcaggcaaaagaacaggcattgttatttagatttgatttgataatattattaaga
gaaatgctttcacctgacggattagatagaatgtctcgttcaaggaaatatgtgagtcaa
ttttcagactacttcctcgccaggttgaagaaaaggttaaagaaatcacctgcttggttt
gttggattacttttcccgccattacacaatagtgaagtaggattttaccaaagatatggt
gaatataatgtacttaataatgaatcaatgtatgccgctcctgcatcacagttcaaacca
attcccgatgaagaagccttaccaccttcgattttgttggatatgaaatatggtgtttta
gtttccacattacttgatgatggaaaaactgaactattggaccaactgctcaagcatata
acccacacactagatatttttaagtcgtggctaaccgtaaatgttaatgctgggaaagaa
acagttaatccacccaatgaatatttcacattgacaggtgtactcaacaacgaccctatt
tttaaagataaggactacagggctttattgttgctgataggatactccattccacgtaaa
atcaatgaaccttgttttttaccggggactgttgaagtttctgacctgactgtttcttgt
gaactagtgaaaaaatacttatcaacaccatttgaaactccaaacggactgccttcttct
tcctatcttctacgagttcgttcagaaaaggatagtttttctcacaatgaacaagatgga
tgggaaggagacgatgattatgattacaacgatccctacattgttccagatgatcaaatt
ttatcgaaaagcgacgcagcatacttcaaggatttagataacaatgcatcagataaactt
aaaggtaccaaattcagtaaagggattgcgagatccaaaaaaaaagataagaggaagcgt
aggaaaggagaagccaagactaatttgccaatgtttggcgaccaggatgatgaacgacct
cagaccgttagagaacgccatggcgtattcagtaaagagtttattagtgattcagaagat
gacgaggatttgatgaaccctatattttttgaaaacgaaacatatatgagatggttacta
gataaaaacaatggtcagttgaccgaggatagatatatccagtttgccaaatttgccgcg
gaaaggatgaataatgggggtgttgtgacaggagattatacgagcttgtttggtggatcc
ataccaagtattgaaagcataagagctacagaaagtagttcctttgcgccagataaaagc
ctcatttctttagcaagccacgtggcatctgaaatgtctattttcgatgtaaataataac
aataataatcaactctctgatgacgatgtcaactcggaatcaagaaatagtttgggctca
tcacagccatcaaattcgcaaaatatgttccaatctgaggtgtatagcagaaaagaatct
acaaagcgttctttggaagcgagtgcagccgatgaaagcgatgaagatgaagaggccatc
cgcctttttggcaaaaagtctagagttgttttgagccaaggtgatagtgatgattga

DBGET integrated database retrieval system