KEGG   Saccharomyces cerevisiae (budding yeast): YNL274CHelp
Entry
YNL274C           CDS       T00005                                 

Gene name
GOR1
Definition
(RefSeq) glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00630  Glyoxylate and dicarboxylate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YNL274C (GOR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     YNL274C (GOR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN NAD_binding_2 AlaDh_PNT_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 855447
NCBI-ProteinID: NP_014125
SGD: S000005218
UniProt: P53839
Position
XIV:complement(121118..122170)
Genome map
AA seq 350 aa AA seqDB search
MSKKPIVLKLGKDAFGDQAWGELEKIADVITIPESTTREQFLREVKDPQNKLSQVQVITR
TARSVKNTGRFDEELALALPSSVVAVCHTGAGYDQIDVEPFKKRHIQVANVPDLVSNATA
DTHVFLLLGALRNFGIGNRRLIEGNWPEAGPACGSPFGYDPEGKTVGILGLGRIGRCILE
RLKPFGFENFIYHNRHQLPSEEEHGCEYVGFEEFLKRSDIVSVNVPLNHNTHHLINAETI
EKMKDGVVIVNTARGAVIDEQAMTDALRSGKIRSAGLDVFEYEPKISKELLSMSQVLGLP
HMGTHSVETRKKMEELVVENAKNVILTGKVLTIVPELQNEDWPNESKPLV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaccaattgttttgaaattaggaaaggatgcctttggtgaccaagcctgg
ggggaattggaaaagattgcggatgtaattaccatccctgaatccaccactagagaacag
tttttgcgggaggtaaaagacccacaaaataagctctcccaagtacaagtcattactaga
acagcaaggagtgtgaaaaacaccggtagatttgatgaagagcttgctcttgctttgccc
tcctccgtagtggctgtatgtcatactggtgctggttatgaccaaattgatgttgagcca
ttcaagaaaaggcacatccaggttgccaatgttcctgatttagttagcaatgctaccgct
gatacgcatgtatttttgctattgggtgccctaagaaacttcggtattggtaacagaagg
ttgatcgagggaaactggccggaggcaggacccgcatgtggttctccctttggatacgac
cctgaagggaaaacagttggtatactgggtctaggtaggattggtcgttgtattttagag
agattgaagccgtttgggttcgagaatttcatatatcataacagacaccagcttccttcc
gaagaagagcatggttgtgaatatgtaggattcgaggagtttttgaagcgttctgatata
gtatctgtaaacgtcccactgaaccacaatactcaccatctaatcaatgcagagactatt
gaaaaaatgaaagatggtgtagttattgttaacacagcgcgtggtgccgtgatagacgaa
caagccatgactgatgctttgcgttctggaaagattagaagtgctggtttggacgttttc
gaatatgagccaaaaatatccaaagagttattatcgatgtcccaagtcttaggactgcct
catatgggcacacatagtgtagaaacaagaaagaaaatggaagaactggtcgttgaaaat
gcaaagaatgtgatattgaccgggaaagtcttgactattgttccggaattacaaaatgaa
gactggcccaatgaatctaagccattagtttga

DBGET integrated database retrieval system