KEGG   Saccharomyces cerevisiae (budding yeast): YNL293WHelp
Entry
YNL293W           CDS       T00005                                 

Gene name
MSB3, GYP3
Definition
(RefSeq) Rab GTPase-activating protein MSB3
  KO
K19953  TBC1 domain family member 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL293W (MSB3)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    YNL293W (MSB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 855423
NCBI-ProteinID: NP_014106
SGD: S000005237
UniProt: P48566
Position
XIV:80640..82541
Genome map
AA seq 633 aa AA seqDB search
MQNDQQRFSLQNRTVLAHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDSALVNGSFRAN
DHRSVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRAEGEDDDDNNGDNGNEDLEEVHSD
DLDLVPDDDNRQRVELEGAASATSANSNGINNTHFDRYGFKKQNNYISEAEYDKWWVEYS
QYCVRRKHKWQLLLEKSGLPVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQ
EKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGP
PIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNI
NLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYR
LPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKIKP
RNNSLNYSWGSNLNQRGGSMGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLNR
LDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSEADLPINDNTDNKGIHITSDAVNEALSS
EVYGFKKSLAGVHWNNSIKEKVKQMRKKKDKGD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgatcaacagaggttctccctgcaaaataggacggtactggcgcatccatac
aaaaggctaggaggggcatttacggtgaaatcaccgtctgttcctaactttcatgataaa
atgcattcagatcatagttctagcgactcagctctggtgaacggaagctttagagcgaat
gatcatcgctctgtggaaccaagttgtttgggccaagcatccccctctgaacatgatggg
aatttaagcgttattgacctgtatggagacgaagtggaatcccaacgtgccgaaggagag
gatgatgatgataataatggcgataatggtaacgaagatctggaggaagtgcacagtgat
gacctcgatttggttcctgatgatgacaaccgtcagcgtgtagaattggagggtgccgct
agtgccacaagtgcgaattccaatggaatcaacaatacccattttgatcgatacggtttc
aaaaaacagaataattacatatctgaagcagaatacgataagtggtgggtagaatattcg
cagtactgcgttcgccgtaagcacaaatggcaattgctgttggagaaaagtgggttgcca
gtgaccgatgattctccttcacgatttccatcaaagagtgaacggttaaaaaggtatgtc
agaaagggcattccagcggaatggagaggaaatgcatggtggcatttcgctagagggcaa
gagaagttaaacaagaataaaggcgtctattcacaacttttacgaaagatgaagcagatc
aagaaacaaaaccctaatgaaaaacaagttcaagacttggatattattgaacgtgacttg
aatagaacatttccggacaatatacatttccaaagtagcttgcataacaaagagggacct
ccgattataaaatctttacgccgggtgcttgttgcgttctctctctacaatccgaagatt
ggctattgtcaatctatgaactttcttgcaggcttgctattgttatttttagacgaggaa
agggccttttggatgctagtgattattacttcaagatacctaccgggggtgcataatatc
aatctagaaggtgttaacatcgaccaaggggtactgatgctatgtgtcaaagaatatatt
ccagaagtttggtcgtacattaagccttccattgaccaccaccaaaaaaataacaaaact
ttttctccgtcaaataaaaaagttttattcaatatgcaaaagaatgagttcttgtacaga
cttccgcccattactttgtgcacggcgagctggttcatgagttgctttgtcggtgtagtg
ccgatagagaccacgcttagaatatgggattgtctgttttacgaggaatcacattttcta
ttcaaagtttcgttggctgtcttaaaattgagcgagcatgacctttcgaaaataaaacct
cgtaacaattcgttgaattattcttggggctctaacttaaaccagagaggcggatcaatg
ggccaagaagatagcgatatggaaatttttcaggtcatacagacattccctaagacatta
ttgaacccaaatgagatctttgagaaaatcattttcaaaaggagatttaatttaaatagg
ttagatcaggatgaaatagacaggtgtcgaaaatttgttgccgctcagcgtctcaaattt
aagacatatggtgaacttcttggaaattcaacatcagaggcagatttgccaattaatgat
aatacagataataaaggtatccacataacaagtgatgcagtcaatgaagcattatcttca
gaggtatatgggtttaaaaagagcctagctggagttcattggaataatagcatcaaggag
aaagtgaagcagatgaggaagaaaaaagacaagggtgactaa

DBGET integrated database retrieval system