KEGG   Saccharomyces cerevisiae (budding yeast): YNL297CHelp
Entry
YNL297C           CDS       T00005                                 

Gene name
MON2, YSL2
Definition
(RefSeq) Mon2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DCB Sec7_N Mon2_C
Motif
Other DBs
NCBI-GeneID: 855420
NCBI-ProteinID: NP_014102
SGD: S000005241
UniProt: P48563
Position
XIV:complement(71673..76583)
Genome map
AA seq 1636 aa AA seqDB search
MAMNTGGFDSMQRQLEAELRSLSSESKRRNSTIRHASDKSIEILKRVHSFEELERHPDFA
LPFVLACQSRNAKMTTLAMQCLQGLSTVPSIPRSRLSEILDAFIEATHLAMEIQLKVLQV
VPIFFKTYGKFIYGPLCKKLLLCCSNLLHVPNKAPVVVGTASATLQQLIDEIFDRLSIES
VVDDKQYEVLISNSESIKVNVYRYDANKLFDNICSLNEISSNGAVSDEEMLLDIGDIPID
YGLEILESILKNSQKNLLECQDLQYLLRVKAIPLLLRCISSSRHFSTAVRSCRCLKLLIR
KEYLSILELELEVILSLLIHGISVESNLSGWQRVLSLELFKDLSQDPEIVNTLYMDYDNY
PDKKHVFKYLLKECIVLLNSPEYITFLAPSKVVEKMDSPLITTENSTVKTKFMHLLDKSN
APSINITYIISLILTICNHLCEGLNKSALESSPLEKKIEDKEREEGTGNDSTVVKVYSGL
FSGLFELNKLFLYSTSLETSIFHLVVRAFQKLAHSAGVLSLKDKLRACMKLFSILITNNV
TSSNQYSFNDTSKSAKNQHTRNISTSSVTTSPVESTKNPSRSIADSAQNKEMKRRLHPRN
ISSRQVSLLRALISLSISLGPIFDSESWRYTFLTWQWITYYIYGPSADFKESFYSEDIPP
PPILTKSDVTSIESSLTKFFESTSSYSCSTFHLVLTRLILDSKNTLTLEQTNLNLNNDIG
YHPLDAKDEIIPCIYNKAFFVNKIGELATYNCKKFLFGKNGKELWSLISTYMIKLISNRE
MDNDSLRLYTVRVFTDIIKKATNEVGNSDEQDNKVKQFGTLENLVIDSLMATINSIKQLD
IGKQEIYNGTINVESDILFQLLLTLKEILNEFGELLMNSWTNIFNIINSPFEWTVEDTDF
SVNEDIDDSSLFEGIVQKHKNMIQVSYDVFKLISDDFLQSLPMSVIKFVIDTLVNFVSQK
RNLNISFSSISQFWLVGDYLRVRFNPETLNLSDEKRRSLSEKINNQKLIEIITSSSSHDW
ELYNGLWIYLLKNLINCTNDDRVEVKNGAVQTFFRIIDSHSVCFPPWDLIFLEVIEPLLT
KEWSTEELENETDFINVTLQGLIKLYPEHFKDFKNNTTCAKEWSMLLDFLKRLLSSTSNN
TKNAVILNYQTLLKEIITIEDVPSDILKKCCEIFTDYNITYSDLSTNASSKTEYDCIYEL
ITGFPPLYQLISKYDAMTDEFVEKVLLLFNSAIKYPLLPEFVQDKTKPSSMQKAILSGLD
IFMTNDSKDTEILILLQLSTISILAFDTREKITKKLGPKLPKASLNRLPTFEAISYMSCS
NLRNRIAKIDQFGISTLKAKHILRILKNLAEIIKRKSLITGSESDEIPIWVLASNCFCDL
SNKIFKSLQEDAENPLKDNFCDLFINVIVVTLQRINPELDNLTEIDDLNEYSKYREILLE
NRIIDLFNERQLDTFIYAVWDCSFLYEFDELENALMQDCGTFSELSQKLSSFDFSCIFGS
TTNPRFQTKYKCSLECLQDLVNFMLNTNEKLRKLTAPYLSARIALALRRYISDEYLIGRA
PIPKLRKTELATLLNGLCVILRGVLDQNSTLGNKQIGVENLQTLSPLILRTIPVSHKMDG
LQDKVLELSLGFTKLD
NT seq 4911 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaacactggagggtttgactccatgcaaaggcaacttgaagcagaattgcgt
tctttatcttccgaatcgaaaagaagaaattcaaccattcgccatgctagtgataaatcc
attgagatattgaaaagagtacatagttttgaggagctagaaagacatccggatttcgca
ctccctttcgtgttggcttgccaatcaaggaatgctaaaatgacgaccctggcaatgcaa
tgcctacagggactgtcaaccgttccatctattcctcgaagccggctgtctgaaattttg
gatgccttcattgaggctactcatctcgcgatggagattcaattaaaagttttacaggtg
gtacccattttttttaagacatacgggaagttcatctatgggccgctttgtaagaagttg
ttgctgtgttgctcaaatctgctgcatgtacctaataaggcacccgtagtagttggtact
gcgagtgccactttacagcagcttatcgatgaaatatttgataggctttccattgaatct
gtagtggatgataaacaatatgaagtcctcataagtaatagtgagtcaattaaggtcaat
gtttatagatacgatgctaacaaattgttcgataatatctgttcattaaatgaaataagc
tcaaatggggcagttagtgacgaggagatgctgttagacattggggacatcccaatagac
tatggcctggaaatccttgaatcgattttgaagaatagtcagaaaaatcttttagaatgc
caagatttacaatatctactgagagttaaggcgattccattgcttctacgttgcatatct
tcttcgagacacttctccaccgctgtaaggagttgtcgttgtttgaagttgttgataaga
aaagagtacctaagcatactcgagttagaattagaggtcatcttgtcgctgttaatccat
ggcatatctgtcgaatccaatttaagtggatggcaaagagtactatctctagaacttttc
aaggatttatcacaagaccccgaaatcgtcaatacactctatatggactatgataattat
ccagataaaaaacatgtgttcaaatatcttttgaaagaatgtattgtcttattaaattcg
ccagagtatattactttcttggcgccatcaaaagtagtcgagaaaatggattctcccttg
ataactactgaaaactctacagttaaaacaaagtttatgcatttattggacaaatcaaac
gctccgtccattaatattacttacattatatcattaattctgaccatctgtaaccactta
tgcgaggggttgaacaaatcggctctggaaagctctcccctagagaagaaaattgaggac
aaagaacgtgaagagggaactggaaatgattcgacagttgtaaaggtttatagcggcctg
ttttctggcctatttgagctaaacaaactctttttatattcgacctccttagagacatcg
atattccacttggtggttagagcttttcaaaaattagctcatagtgccggcgttctgtca
ctaaaggacaaattaagggcatgcatgaaattgttttcgattttgataacaaacaacgtt
acatcatccaatcaatattcttttaatgatacaagtaagtcagcaaaaaatcaacataca
agaaatatatccacatctagtgtcacgaccagtcccgtagaatcaacaaaaaatccaagt
aggtcgattgcagattctgcgcaaaataaggaaatgaaaaggcgtttgcaccccaggaat
attagttcaagacaagttagtttactaagggcattaatatcattatcaatatcactaggt
cctattttcgattcagaaagctggaggtacacttttttaacctggcaatggataacttac
tacatatatggtccatcagcagatttcaaagagagcttttactctgaagatattccacca
cctccaatactgactaaatcagacgttacatctattgaaagctctctaacgaaatttttt
gaaagtacaagcagctattcttgctcaacttttcatttggtattaaccagattaattttg
gactcaaaaaataccctcactttagaacaaacgaacctcaacctgaataatgacattggc
tatcatcctttagatgcaaaagatgaaattataccatgcatttacaacaaggcgtttttt
gttaacaaaattggtgaactggcaacttataattgcaaaaaatttctctttggaaaaaat
ggtaaagaactttggagtttgatttccacctatatgatcaaattgatatcaaaccgtgaa
atggataacgattctttacgtttatacacagtgagagtgtttacagatatcatcaaaaag
gctactaatgaggttggtaattccgatgagcaagataataaagtgaaacagtttggtaca
ttggaaaacttagtcatcgatagcttgatggcaacgataaactcgataaaacagttggat
attggtaagcaggaaatatacaatgggacgatcaatgttgaatcagatattctttttcaa
ttgctactaactttaaaagagattctgaacgaatttggtgaactgttaatgaactcttgg
accaatattttcaacatcattaattcaccattcgagtggacagttgaggatactgatttt
tccgtgaatgaggatatagatgattcatctttatttgaaggtatcgttcagaagcataag
aacatgatccaagtgtcatacgatgtttttaaactaatttctgatgatttcttacagagt
ttacctatgagtgtcattaaattcgttattgatacgcttgtcaatttcgtaagtcagaag
cgaaatcttaatatctccttttcttctattagtcagttctggttagttggagattatctc
agagtccgcttcaatcccgaaacattaaatttaagtgatgagaaacgtagaagtctctcc
gaaaagattaataatcaaaaattaattgaaatcattacatccagttcatctcatgattgg
gaactttacaacggattatggatatatcttttgaaaaatttgatcaattgtactaatgat
gatagagtagaagttaaaaacggtgctgtgcagacttttttcagaatcatcgactcccat
tctgtttgcttccccccatgggacctaattttcttagaggttattgaaccactgcttacc
aaggaatggtccactgaagaactcgaaaatgaaactgattttataaatgtaacattgcaa
ggattaattaagctttatccggaacactttaaggacttcaaaaacaacactacctgcgcc
aaggaatggtcaatgttattagattttttgaaaagattgttgtcttccacttctaataat
accaagaatgctgtaatattaaattatcaaaccctgctgaaagaaatcatcactattgag
gacgttccatcagatatattgaaaaagtgctgcgaaatatttaccgactacaatattacg
tacagtgatctctccacaaacgcatcgagcaaaactgaatacgattgtatatacgaacta
ataaccggatttcctcctctttaccaattaatatcgaaatacgatgcgatgacagatgaa
tttgtggaaaaagttcttcttttattcaattctgccataaaatatcctctcttacctgag
tttgtccaagacaaaactaaaccgtcctctatgcaaaaggccatattgtctggacttgat
atatttatgacaaatgattctaaagatacagaaattttgattcttctccagttaagtaca
atatcgatattggcttttgatacaagggaaaaaataacaaaaaaacttggaccaaagctt
ccaaaagcatcacttaacaggttaccaacttttgaggcaatcagctatatgtcatgttct
aacctgagaaatagaatagcaaaaatagatcaatttggtatatccacactgaaagcaaag
catattttaagaatattgaaaaatttggctgaaatcatcaagcgaaaatcgcttattaca
gggtcagagagtgatgaaatccccatatgggttcttgcttccaattgcttctgtgatttg
tcgaacaaaattttcaaatcactccaagaagatgcagaaaatccattaaaggataacttt
tgtgatttatttataaatgttattgttgtcacattacaaagaatcaacccagagctcgat
aatttaaccgagatagacgatttgaatgagtattccaaatatagggagatattgctggaa
aacagaatcattgatctcttcaatgaaaggcaattagacactttcatttatgccgtctgg
gattgttcatttttatatgaattcgatgaattagaaaatgctttgatgcaagactgtggt
acgttttctgaattgtctcaaaaactatcttcgttcgatttttcatgtatatttggatcc
accacaaatcctcgctttcagacaaaatataagtgctctttagagtgcttgcaagatttg
gttaattttatgttgaacacaaacgagaaattaagaaagttaactgctccttatctttct
gcaagaattgcccttgctcttagaagatatatctcagatgaatacttgattgggcgagca
ccaataccaaaattgcgtaaaacagaactagctactctattaaatgggctatgcgtgatt
ttaagaggtgttctagatcaaaattcgacccttggcaacaaacaaattggagttgaaaac
ctacaaacattaagtccgttgattttaagaaccatcccagtatctcataaaatggatggc
ctccaagataaagttttggaattatcacttggatttacgaaactagactag

DBGET integrated database retrieval system