KEGG   Saccharomyces cerevisiae (budding yeast): YNL298WHelp
Entry
YNL298W           CDS       T00005                                 

Gene name
CLA4, ERC10
Definition
(RefSeq) serine/threonine protein kinase CLA4
  KO
K19833  serine/threonine-protein kinase CLA4 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YNL298W (CLA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YNL298W (CLA4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YNL298W (CLA4)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  STE20 family
   YNL298W (CLA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD PH Kinase-like Pkinase_fungal PH_11 APH
Motif
Other DBs
NCBI-GeneID: 855418
NCBI-ProteinID: NP_014101
SGD: S000005242
UniProt: P48562
Position
XIV:68915..71443
Genome map
AA seq 842 aa AA seqDB search
MSLSAAANKISDNDFQNIGPAPRPPSSNSQGRTCYNQTQPITKLMSQLDLTSASHLGTST
SKKKSGWVSYKDDGILSFIWQKRYLMLHDSYVALYKNDKQNDDAILKIPLTSIISVSRTQ
LKQYCFELVRCSDRNSVSSGSSSSLNVSSDSNSKKSIYIATKTESDLHSWLDAIFAKCPL
LSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNNSAAVIQVLQFY
QEYNGAGNPTNTLDKPQSGETSSSQKSLPNSYNDNKLRNNSVNSKSSSGVSSSMVSQRKT
SQPPNTKSPVSLGSGSLPPINTKLPTSQSNIPRHLQNVPNQQYPKMRNGHSPTNGQFPRG
PMHPNNSQRSLQQQQQQQQQQKQQHQQYPYHHQGPSPSPSPSPSPLNPYRPHHNMINPYS
KQPQSPLSSQSTQNQAIPRYAQNSSPTAAHFQPQRTAPKPPISAPRAPYPSNQNATSNTH
VQPVAPKNDQSTPQTMRQAPKRPDADVAQPGGVAKPKKPARPTMSTAEIMSKLKKVTVNA
DPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSK
QPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDN
SHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTD
KRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLI
ATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFNMACDPKDLTSLLEW
KE
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttcagctgcagcgaataagatatctgacaacgatttccaaaatatcggaccg
gcacctagacctcccagttcaaatagccagggccgtacttgctataatcaaacgcaacct
ataaccaaacttatgagtcaactggatttaacatcagcgtcccatttaggtacaagtacc
tccaaaaaaaaaagcgggtgggtgtcctacaaagatgacggtatactttcatttatatgg
caaaagagatacctgatgctacacgattcgtatgtagccctttacaagaacgataaacaa
aatgacgatgcgatcttgaagataccactaactagtattataagtgtaagcaggacacag
ttgaaacaatattgttttgagttggtgcgctgcagtgaccgaaattctgtatcatcagga
tcctcgtcctctttgaatgtatcatcagacagtaactccaaaaaatcaatatacattgct
acaaagacagaaagcgatttgcatagttggttagacgccatttttgctaaatgtccatta
ttaagtggtgtatcttctccaacaaacttcacacataaagttcacgttggttttgatcca
gaaacaggtagttttgttggtatgcccaccaactgggaaaaattattaaagcactccaga
attacaggagaagattggaacaataattctgcggctgtcattcaagtgttgcagttttat
caagagtataatggagccggaaatcccacaaatactttagacaagcctcaaagtggtgaa
acttcctcctctcaaaaatcgctgccaaacagctataatgataacaaactcagaaataat
tcagtaaattcaaagtcatcttcaggcgtttcttcaagtatggtatcacagaggaaaacc
tcacaaccaccaaataccaaatcgcctgtttctctaggaagcggctcactgccaccaata
aatacaaaattgcccactagtcagtcaaatattccaagacacttacaaaatgttcccaac
caacaatatcctaagatgagaaacggacactccccaaccaatggccaatttcctagggga
cctatgcatccaaacaattctcaacgatctttgcagcagcagcagcagcagcagcagcaa
caaaaacaacagcatcaacaatatccataccaccatcaaggaccatctccatctccatcc
ccatctccgtctccattaaacccttataggccacatcacaatatgataaatccttattcc
aaacaacctcaatcgccattaagttcacagtcgacccaaaaccaagcaattccacgttat
gcacaaaactcaagtcctacagccgcacactttcaacctcaaagaacagctccaaagcca
ccaatatcagctccaagggcgccatacccatcaaatcaaaatgctactagtaacacacat
gtacagcctgttgcacctaagaatgaccagtcaaccccacaaacaatgaggcaggcccca
aagagaccggatgcagatgtcgcacaaccgggtggtgtggccaaaccgaagaagccagca
aggcctaccatgtcaactgcagaaataatgagtaagctgaagaaagtcaccgtaaatgcg
gatccatctcaatgctttaaagtgatcgagaaggccggtcaaggtgcaagtgggtccgtc
taccttgcagagaggacgcatattccgacagaaagtaatatgatcgaactcataaacaat
gatattgatgagccgcacgtaggagataaagttgctatcaagcaaatggtcttatctaaa
caacctcgtaaagaactcatagtgaatgaaattttggttatgaaggattcacgtcataaa
aatatcgtcaattttctcgaggcttatttgagaacagacgatgacctatgggttgtgatg
gagtttatggaaggaggttcactaacagacattatcgagaatagtcccaccaacgataat
tcacattcaccactaacagaaccccaaattgcatatatcgtacgagaaacttgccaaggc
ttgaaatttctacacgacaagcatatcattcatagggatattaaatcagataatgtcttg
ctggacactagagctagggtgaaaattaccgattttgggttttgcgccagattaactgat
aaaagaagcaaaagagccactatggttgggacaccttactggatggcacctgaagttgtc
aaacaacgtgaatacgatgaaaagattgacgtatggtctttgggtatcatgaccattgaa
atgctggagggtgaaccaccatatttaaatgaagatccactaaaggcgttgtacttaatt
gcaactaatggtacaccaaagctcaagcatccagaaagtttgtctttagaaattaaacgc
tttctaagcgtttgcctttgcgtagatgttagatatagggcatcaaccgaagagctttta
caccacggttttttcaatatggcatgtgatccaaaggatttgacatcactgttggagtgg
aaggaatga

DBGET integrated database retrieval system