KEGG   Saccharomyces cerevisiae (budding yeast): YNL314W
Entry
YNL314W           CDS       T00005                                 

Gene name
DAL82
Definition
(RefSeq) Dal82p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Myb_DNA-bind_5 JUPITER Myb_DNA-bind_3
Other DBs
NCBI-GeneID: 855402
NCBI-ProteinID: NP_014085
SGD: S000005258
UniProt: P21705
Position
XIV:44447..45214
AA seq 255 aa
MDESVDPVELLLRLLIRHKPHLKPYAYRQDSWQRVLDEYNRQTGSRYRQSRTLKTKFRRL
KDLFSADRAQFSPSQLKLMGALLDEAPEHPRPRTKFGNESSSSLSSSSFIKSHPGPDPFQ
QLSSAEHPNNHSSDDEHSGSQPLPLDSITIGIPPTLHTIPMILSKDNDVGKVIKSPKINK
GTNRFSETVLPPQMAAEQSWSDSNMELEICLDYLHNELEVIKKRQEDFECKVLNKLNIIE
ALLSQMRPPSQGDKI
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgaatcggtggatcctgtggagctgcttctacgactactgatacggcacaaacct
catctgaaaccatatgcctacagacaagatagctggcaaagggtgctcgatgagtacaac
agacagactgggtcaagatatagacaatcaaggacgttaaaaaccaaatttcgtcgactg
aaggacctcttcagcgcagatcgagcccaattctctccttcccagttgaagctgatggga
gcactcttggacgaagcaccagaacatccaagaccaagaactaaattcggaaatgaatca
tcttcatccttatcatcatcttctttcattaaaagtcatccggggcctgatccgtttcaa
caattatcatccgctgaacatccgaataaccacagctccgacgatgagcattcaggctca
caaccgctgcccctggattcaataacgattggaattccgcctactcttcacacaatcccc
atgattctgtctaaggataacgacgtcgggaaagtcatcaaaagccctaagataaacaag
ggtacaaataggttcagcgagacagtactgcctccacaaatggctgctgagcaatcgtgg
tcggactctaatatggaattggaaatatgtctagattatcttcacaacgaactcgaggtg
ataaagaaaaggcaagaagattttgagtgtaaagttttaaacaagctcaacataattgag
gctctcctttcacagatgagaccacccagccaaggagataaaatataa

DBGET integrated database retrieval system