KEGG   Saccharomyces cerevisiae (budding yeast): YNL318C
Entry
YNL318C           CDS       T00005                                 
Symbol
HXT14
Name
(RefSeq) Hxt14p
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YNL318C (HXT14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL318C (HXT14)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YNL318C (HXT14)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 855398
NCBI-ProteinID: NP_014081
SGD: S000005262
UniProt: P42833
Position
XIV:complement(38707..40329)
AA seq 540 aa
MTAQIPYQHSSGYISHFHNNELDAGRGRDYNVTIKYLDDKEENIEGQAAKISHNASLHIP
VLLCLVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGL
IISIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVT
GIGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNI
AWQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEF
IDDLLENNYNNEETNNESKKQSLVKRNTFEFIMGKPKLWLRLIIGMMIMAFQQLSGINYF
FYYGTSVFKGVGIKDPYITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYMMT
YATVGTFGRETDFSNIVLIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFI
NWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEINKIFEPE
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgactgctcagattccgtatcaacatagctcgggatacatctctcattttcacaataat
gagcttgatgcaggcaggggaagggattataatgtaaccattaagtatctagatgataaa
gaagaaaatatagaaggccaagcagcaaagattagtcacaatgcgagtctgcatattccc
gttttattgtgcttggtaatctcgcttggtggctttatttttggatgggacattggaacc
atcggtggaatgacaaatatggttagctttcaagaaaaatttggcacaactaatattatc
catgacgatgaaacaatttttgtatctactaagaaacttactgatctgcaaataggccta
attatcagtatttttaacatcagttgtggcgtaggggctttaactctgtcaaaaatcggt
gattggattggtaggaaaggtggtatatggtttgccttagtagtgtactgcatcggtata
accattcaaattctctcctatggaaggtggtattttttgacattgggaagagccgtaacg
ggaatcggtgtgggagtaaccactgtcttggtgccaatgtttctctccgagaattctcca
ctaaaaatcagaggctccatggtatctacgtatcaattgattgtaacatttggcatacta
atgggaaacattttaaatttcatatgcgaaagatgttataaagatcctacacaaaatata
gcctggcaattgccattgttcttgggatacatttgggcaattataattggaatgtcactt
gtttacgttcctgaatctccacagtacttggcaaaaatcaaaaatgatgtgccctctgct
aaatactcttttgcgaggatgaatggcatccctgcgacggatagcatggtaattgaattc
atcgatgatttgctggaaaataactataataatgaggaaactaacaacgaatcaaaaaag
caaagcttagttaaaagaaacacatttgaatttattatgggaaagccaaagttatggttg
agactgattattggtatgatgataatggcatttcaacagctgtccggaataaattatttc
ttttattacggaacgtctgttttcaaaggtgtcgggattaaggatccttatattacttca
atcatactgtcaagtgttaacttcctttctacgatattaggcatatattacgtggagaaa
tggggccacaagacatgtttattatatggttcaacaaatttattattttatatgatgaca
tatgctactgtggggacatttggaagagaaacggacttctcaaatattgttttaattatc
gtgacttgttgttttattttttggtttgcaataacattgggcccagttacatttgtacta
gtgtccgaattgttccctctaagaacgagggccatatcaatggctatttgcacatttatc
aattggatgttcaatttcttaatatcacttttaacaccaatgattgtatccaaaattgat
ttcaaactaggatacatatttgctgcttgcctattagcgttgataatattcagttggata
ctagttcctgaaacgaggaaaaagaatgagcaagagatcaataaaatatttgaaccggag
tag

DBGET integrated database retrieval system