KEGG   Saccharomyces cerevisiae (budding yeast): YNL330CHelp
Entry
YNL330C           CDS       T00005                                 

Gene name
RPD3, MOF6, REC3, SDI2, SDS6
Definition
(RefSeq) histone deacetylase RPD3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YNL330C (RPD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL330C (RPD3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YNL330C (RPD3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     YNL330C (RPD3)
   HDAC complexes
    Sin3A-HDAC complex
     YNL330C (RPD3)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    YNL330C (RPD3)
  Chromatin remodeling factors
   NuRD complex
    YNL330C (RPD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 855386
NCBI-ProteinID: NP_014069
SGD: S000005274
UniProt: P32561
Position
XIV:complement(18001..19302)
Genome map
AA seq 433 aa AA seqDB search
MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRD
GIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKS
FGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNM
FNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQY
ARDLHVEHDNEFY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgaagcaacaccttttgatccgatcacggtcaagccaagcgataaaagacgc
gttgcatatttttacgatgcagacgttgggaactatgcatatggagcaggtcacccgatg
aagccgcatagaataagaatggcacattcccttattatgaattatggcttgtacaagaag
atggaaatttacagagctaagccggcaacgaaacaagaaatgtgtcagttccatactgat
gaatacattgattttttatcgagggttactccagataatttagaaatgtttaaaagagaa
agtgtcaagtttaatgtcggagatgattgtcctgtctttgatgggctctatgagtactgt
agcatatctggtggtggctctatggaaggagctgctcgtctgaatagaggcaaatgtgat
gttgctgtcaactatgcgggtggtttgcatcatgcaaaaaaatcggaagcttctgggttt
tgttatttaaatgacatagtactgggcattattgagctactacgataccaccccagagtt
ctgtatattgatattgatgtgcaccatggtgatggtgtagaggaagcgttttatacaacg
gatcgtgtcatgacatgttctttccacaaatatggtgagtttttccctggcacaggtgaa
ctgagagatataggggtgggtgcaggaaaaaactacgcggtcaatgtgccattaagagac
ggtattgacgatgctacgtatagatctgtgtttgaacctgtgataaaaaaaattatggaa
tggtatcaaccttctgctgtcgtgttacagtgtggtggggactccttgtccggcgatcgt
cttggttgctttaatctttccatggaaggccatgctaattgtgtaaactatgtgaaatcc
tttgggatcccaatgatggttgttggtggaggaggctatactatgagaaatgttgcaagg
acatggtgctttgaaacaggtctactaaataacgttgtcttggataaagatttaccgtac
aatgaatattacgaatattacggtccagattataagttaagtgttagaccttcgaatatg
ttcaatgtaaatactcccgaatatcttgacaaggtaatgaccaatatatttgctaatttg
gaaaacacaaagtatgcccctagtgttcagttgaatcacacacctagggatgccgaagat
ttgggtgatgttgaagaagattctgccgaggctaaagatacgaagggtggttcgcaatat
gcgagggacctacatgttgagcatgacaatgaattctattga

DBGET integrated database retrieval system