KEGG   Saccharomyces cerevisiae (budding yeast): YNR003CHelp
Entry
YNR003C           CDS       T00005                                 

Gene name
RPC34
Definition
(RefSeq) DNA-directed RNA polymerase III subunit C34
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03020  RNA polymerase
Module
sce_M00181  RNA polymerase III, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    YNR003C (RPC34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YNR003C (RPC34)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     YNR003C (RPC34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpc34 Rrf2 CDC13_N RPA_C HTH_46
Motif
Other DBs
NCBI-GeneID: 855737
NCBI-ProteinID: NP_014400
SGD: S000005286
UniProt: P32910
Structure
PDB: 

Position
XIV:complement(634344..635297)
Genome map
AA seq 317 aa AA seqDB search
MSGMIENGLQLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNL
IKLVKQNDELKFQGVLESEAQKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHV
VLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDITGGPWFTDGELDIEFINSLLT
IVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNI
RSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMF
PASKHDKEVVYFDEWTI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaatgatagaaaatgggttacagctatcggacaatgctaaaaccttacatagc
cagatgatgtcgaaaggaataggcgcattatttacacagcaagaactccaaaaacaaatg
ggaatcgggtcgttaacagacttgatgtccattgtacaggaattgctagacaagaacttg
atcaaattagtaaaacaaaacgacgaattaaaatttcaaggtgtcttagaatctgaggcg
caaaagaaagccaccatgtcggctgaagaggcactggtatattcttatatcgaggctagc
ggtagagaagggatatggtccaagactatcaaggcaagaaccaatctccatcagcatgta
gttcttaaatgcttgaagagtttagaatcccaaagatacgtgaagagtgttaagagtgta
aagtttcccacaaggaaaatctacatgttgtacagcttacaaccctctgtggacatcaca
ggaggtccatggttcacagatggagagctggatatagaatttatcaatagtttattgact
attgtttggaggttcatatcagagaacaccttccctaatggcttcaagaatttcgaaaat
ggacccaaaaaaaacgtcttttatgctccaaacgtaaaaaattactctaccacacaagaa
attttggaatttattacagcggcacaagtggccaatgtcgagttaaccccttcaaatatc
agatctttgtgtgaagtcttagtgtacgacgacaagctggaaaaagtcacgcatgactgc
tatagagtgaccttagagagcattctacaaatgaaccaaggtgagggcgagccggaggca
ggtaataaggctttggaggatgaagaagaattttccatctttaactacttcaagatgttt
ccggcttcaaaacacgacaaggaagtggtctatttcgatgaatggacaatttga

DBGET integrated database retrieval system