KEGG   Saccharomyces cerevisiae (budding yeast): YNR012WHelp
Entry
YNR012W           CDS       T00005                                 

Gene name
URK1
Definition
(RefSeq) uridine kinase URK1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00240  Pyrimidine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YNR012W (URK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     YNR012W (URK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK UPRTase AAA_18 Zeta_toxin CPT AAA_33
Motif
Other DBs
NCBI-GeneID: 855746
NCBI-ProteinID: NP_014409
SGD: S000005295
UniProt: P27515
Position
XIV:647432..648937
Genome map
AA seq 501 aa AA seqDB search
MSHRIAPSKERSSSFISILDDETRDTLKANAVMDGEVDVKKTKGKSSRYIPPWTTPYIIG
IGGASGSGKTSVAAKIVSSINVPWTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINL
DLAYKCILNLKEGKRTNIPVYSFVHHNRVPDKNIVIYGASVVVIEGIYALYDRRLLDLMD
LKIYVDADLDVCLARRLSRDIVSRGRDLDGCIQQWEKFVKPNAVKFVKPTMKNADAIIPS
MSDNATAVNLIINHIKSKLELKSNEHLRELIKLGSSPSQDVLNRNIIHELPPTNQVLSLH
TMLLNKNLNCADFVFYFDRLATILLSWALDDIPVAHTNIITPGEHTMENVIACQFDQVTA
VNIIRSGDCFMKSLRKTIPNITIGKLLIQSDSQTGEPQLHCEFLPPNIEKFGKVFLMEGQ
IISGAAMIMAIQVLLDHGIDLEKISVVVYLATEVGIRRILNAFDNKVNIFAGMIISREKL
QNHQYKWALTRFFDSKYFGCD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcgtatagcaccttccaaagaacgatcttcatcatttatttcaattttagac
gatgaaacaagagacacattgaaagctaatgcagtcatggatggtgaagtagatgtcaaa
aaaacaaaaggaaaaagctctcggtatatcccaccatggacaactccatatataataggt
ataggtggtgcttcaggttcaggcaagacaagcgttgctgctaagattgtgtcgtcaatt
aatgttccctggacagtattaatatctttggataacttttacaatccattaggcccagag
gacagagccagagcctttaaaaatgaatacgatttcgacgagccaaatgccatcaactta
gatttggcatataagtgcattttgaacttaaaggagggcaaaaggacaaatatcccagtt
tatagcttcgtccaccacaatagagttcctgataaaaatatagtcatatacggggccagt
gtggtagttatcgaagggatctacgccctttacgatcgccgattgctggatttgatggac
ttgaaaatttatgttgacgctgatttggatgtctgcttagcaagaagattgtcgagagat
atagtttccagagggagagatttggatggttgtattcaacaatgggagaaatttgtgaaa
ccaaatgcggtaaagtttgtgaaaccaacaatgaagaatgcagatgctatcattccatcg
atgagtgataatgctacagcggtaaatttaatcattaaccacatcaagtcaaaactggaa
ctaaaatcaaatgaacacttaagagagctaatcaaattgggctcttctccttcacaagat
gtgcttaatcgtaacataattcatgaattgccgcccaccaaccaagttctttcgctgcat
actatgcttctaaataaaaatctaaattgcgcggactttgttttctactttgacaggtta
gcaacaattttgttatcatgggcacttgatgacattcctgtagcacatacgaacataatt
acacctggtgagcataccatggaaaacgttattgcctgtcaattcgatcaagttacagct
gttaatattattcgatctggcgattgttttatgaagtctttgagaaagacgatccccaat
atcacaattggtaaattgttgattcagtccgattcacaaactggggaacctcaactgcat
tgcgaatttttacccccaaatatagaaaagtttggcaaggttttcttaatggaaggtcaa
atcataagtggtgcggccatgatcatggccatccaggtgcttttagatcatggtattgat
ttggaaaagattagcgtggtggtttatttggccactgaagttggtatccgacgtatatta
aatgcatttgataacaaagtcaacatttttgctggtatgatcatctccagagaaaagtta
caaaatcatcaatacaaatgggcattgaccagattttttgattcaaagtattttggttgt
gattga

DBGET integrated database retrieval system