KEGG   Saccharomyces cerevisiae (budding yeast): YNR017WHelp
Entry
YNR017W           CDS       T00005                                 

Gene name
TIM23, MAS6, MIM23, MPI3
Definition
(RefSeq) protein transporter TIM23
  KO
K17794  mitochondrial import inner membrane translocase subunit TIM23
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNR017W (TIM23)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNR017W (TIM23)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    YNR017W (TIM23)
Transporters [BR:sce02000]
 Other Transporters
  Primary active transporters [TC:3]
   YNR017W (TIM23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 855751
NCBI-ProteinID: NP_014414
SGD: S000005300
UniProt: P32897
Position
XIV:662913..663581
Genome map
AA seq 222 aa AA seqDB search
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggctttttggagataagacacctaccgatgatgcgaatgctgccgtgggcggc
caagatacaaccaagcctaaggaactatcgttgaagcagagtttaggtttcgagccaaac
atcaataacataatatcaggtcctggtggaatgcatgtcgacaccgctaggctgcatcct
ttggctggtctagacaagggtgtggagtatttagatctggaagaagaacaactatcctcg
ttagaaggctcacagggtctgatcccttcccgtgggtggaccgatgacctatgttacggt
accggtgccgtctacctgctgggacttggtatcggagggttttctggtatgatgcagggt
ctgcagaatattccgcccaatagtcccggaaaattgcaattgaacaccgtcctgaatcac
attactaagagaggtcccttcttaggtaataatgcggggattctcgcgttgagctacaat
atcatcaattctacaatagatgcactaagaggcaaacatgacaccgcgggctccattggc
gctggggccctcacgggcgctttgttcaagtcttcaaaaggtttgaaacccatgggttat
tcctcggcaatggtggccgctgcgtgcgccgtctggtgtagtgtcaagaaaagactactt
gaaaaatga

DBGET integrated database retrieval system