KEGG   Saccharomyces cerevisiae (budding yeast): YNR055C
Entry
YNR055C           CDS       T00005                                 

Gene name
HOL1
Definition
(RefSeq) Hol1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 855792
NCBI-ProteinID: NP_014453
SGD: S000005338
UniProt: P53389
Position
XIV:complement(728426..730186)
AA seq 586 aa
MDKYTNRDHPDYIPGTFNIYSSQNLENGIIYESKLKKTSSGVVLIPQPSYSPNDPLNWSS
WRKLAHFGLMAFITAFTAATSNDAGAAQDSLNEIYGISYDSMNTGAGVLFLGIGWSTLFL
APFANLYGRKITYIVCTTLGLFGALWFALAKRTSDTIWSQLFVGISESCAEAQVQLSLSD
IFFQHQLGSVLTVYIMCTSIGTFLGPLIAGYISAFTNFRWVGWVAVIISGGLLITIIFGC
EETYFDRGQYMTPLTSCQSGYEDGTTLQNSDNTAVSRRKRHLDAKLSTPGAMGEKGVDLS
ETAEFEVNNEEEVTIPETRELIDGSKEHLKPYPKRVAILTKATNLKGYGFKQYFKYLKIN
LRMFLFPPVWLSGMFWGIQDVFLTFYLTTQESAYYEPPWNYSDFGVAIMNVPTLIGAVIG
CICAGIVSDYFVLWMARHNRGILEAEFRLYFSIATAIIGPAGLLMFGIGTARQWPWQAIY
VGLGFVGFAWGCSGDIAMAYLMDCYPDMVLEGMVCTAIINNTISCIFTFTCSDWLAASGT
ENTYIALAVINFGITAFALPMYYYGKRIRLWTKRWYLQSVNLRDGV
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggacaaatataccaacagggatcatccggactatattcctggcacatttaacatctat
tcttcccaaaatttggaaaatggtattatatacgaatcaaaattgaagaaaacctcctca
ggagtcgtcctaatccctcaaccatcatactcgccaaatgatccactgaactggtctagc
tggaggaaattggctcattttggtctaatggcctttataactgcgtttaccgccgctact
agtaacgacgctggtgctgctcaagactcattgaatgagatttatgggatatcctacgat
tccatgaacacaggggctggtgttcttttcctaggtattggttggtccactttattcttg
gctccatttgctaacttgtatggcaggaagattacgtacatagtttgcaccacattaggt
ctctttggtgcgctttggtttgctttggccaaaagaacgagcgacacaatatggtctcag
ttgtttgtaggtattagtgagtcctgtgctgaagcccaggtgcaactgtccctgagcgac
atttttttccagcaccaattgggctccgtattgaccgtgtatatcatgtgcactagtatc
ggtacgttcttgggcccattgatcgctgggtacatatctgcatttaccaacttccgttgg
gtcggttgggtcgcagtgatcatatctggtggccttttaataactattatatttggctgc
gaagaaacgtacttcgacagaggccagtatatgacccctttgaccagctgtcaatcggga
tacgaagacggtaccactttacaaaactctgacaatacggccgtgtcgcgcaggaaacgt
catcttgacgctaaattatcaactcctggagccatgggtgagaaaggtgtagacctttca
gagacggctgaattcgaagttaacaatgaagaggaagttaccatacctgagactcgcgaa
ttgattgatggttcaaaagagcatttgaaaccatacccaaaaagagtagcaatattaacc
aaagctactaatttgaaaggctacggttttaaacagtatttcaaatatctaaagatcaac
cttagaatgttcttattcccgccagtgtggttgtctggtatgttttggggtattcaagac
gttttcctgacgttttatttgaccactcaagaaagcgcctactacgaacctccatggaac
tatagtgattttggtgtcgcaattatgaatgttcccacacttattggagcagtcatcggt
tgtatctgtgctggcattgttagtgactactttgttctttggatggctcgtcacaataga
ggaattttagaggcagaatttagactatacttctctatcgcaactgcaattattgggcca
gcgggtttgctgatgtttggtatcggtaccgctagacaatggccttggcaagctatatac
gtcgggttgggttttgttgggtttgcatggggttgttctggtgatattgcgatggcgtat
ttaatggattgttaccccgatatggttttggaaggtatggtttgtactgctattattaac
aacacgatatcttgcattttcacctttacctgttctgattggctagctgcatctggtact
gaaaatacttacattgctttagctgtcatcaactttgggattactgcatttgctttacca
atgtactactatggtaagaggataagactttggactaagagatggtatttgcaatctgtc
aatttgagagacggtgtgtaa

DBGET integrated database retrieval system