KEGG   Saccharomyces cerevisiae (budding yeast): YOL021CHelp
Entry
YOL021C           CDS       T00005                                 

Gene name
DIS3, MTR17, RRP44
Definition
(RefSeq) exosome catalytic subunit DIS3
  KO
K12585  exosome complex exonuclease DIS3/RRP44 [EC:3.1.13.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YOL021C (DIS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YOL021C (DIS3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     YOL021C (DIS3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     YOL021C (DIS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrp44_CSD1 RNB Rrp44_S1 OB_Dis3 PIN_4 CSD2 OB_RNB Dis3l2_C_term
Motif
Other DBs
NCBI-GeneID: 854138
NCBI-ProteinID: NP_014621
SGD: S000005381
UniProt: Q08162
Structure
PDB: 

Position
XV:complement(282421..285426)
Genome map
AA seq 1001 aa AA seqDB search
MSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVV
PDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAIDLLENPNCFFDVIVPQIVLDE
VRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQW
YSEHLKPYDINVVLVTNDRLNREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDS
FDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVL
IVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSS
NTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQ
NVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAE
TEALLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLIC
SIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKR
IDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLR
IDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKL
LATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISL
ESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYT
HFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIE
YYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNSAAFDEVEYKL
TFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLLK
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcccgctatcgcccccagacggaagagacttgcagatggtttaagcgtcact
cagaaggtgtttgtaaggtctcgtaatggaggcgctaccaagatcgtaagagaacactat
ttaagatcggacatcccatgtctttcgagaagttgtaccaagtgtccgcaaattgtcgtc
cccgatgctcaaaatgagttgccgaagttcatcttgtcagattctcccttagaattaagc
gcacccattggtaagcattacgtcgtcttggataccaacgtggtgttacaggcaattgac
cttttagagaatccgaattgttttttcgacgtcattgtcccccagattgtcctagatgaa
gtgagaaacaagtcatatccggtgtacacgagattaagaactctatgcagagatagtgac
gatcataagagattcatcgtgtttcataacgaatttagtgaacatacttttgtggaaagg
cttccaaatgaaacgattaatgacagaaacgacagggctataaggaaaacctgtcaatgg
tatagtgagcacttgaaaccttatgacataaacgtcgttcttgttaccaacgatcgtttg
aatagagaagctgccactaaggaagtggagtccaatataataaccaagagcttggtacag
tatatcgagttactaccaaatgcagacgacatcagagactctattcctcaaatggattct
tttgataaagatcttgaaagggacacattttcagatttcacgttcccggagtactattct
acagcaagagtaatgggtggtttgaaaaatggcgttttgtaccagggcaatattcaaata
tcagagtacaactttctagaaggttcagtgagtttaccaagattttccaaaccagtgtta
attgttgggcagaaaaacctaaatagagcattcaacggtgaccaggttatcgtggaactg
ctacctcaatcagaatggaaggcaccctcatccattgtcttggattctgaacatttcgac
gttaacgataaccccgatattgaggctggcgatgacgatgacaataatgagtcctcttcc
aataccaccgtgatttccgacaagcagcgcaggctgcttgctaaagatgctatgatagct
caaagatcgaaaaaaattcagcccacggcaaaagttgtatatatacaaagaagatcctgg
agacagtacgtcggtcaactagcaccaagttctgttgatccacaaagcagtagtacacag
aatgtcttcgttattttgatggacaaatgtcttccaaaagtcagaatcagaacaaggcgt
gctgctgaattattggataagaggattgtcatttccattgattcgtggcccaccactcat
aaatacccattaggtcactttgtgagagacctcggtacaattgaatctgctcaagctgaa
acagaggccttattgttggagcatgatgttgaatataggcctttttccaagaaagttcta
gaatgtttgcccgcagaaggccacgattggaaggccccaacaaaactggacgatcctgag
gctgtttcaaaggatccattattgacaaaaagaaaggatctcagagataaacttatatgt
agtatcgatcctccaggatgtgttgatattgacgatgccctacatgcgaaaaagcttcca
aacggtaattgggaagttggtgttcatattgctgatgttactcacttcgttaaaccgggc
actgccctggatgcggaaggtgctgcaagaggtacttctgtatatttggtagacaaacgt
attgacatgctgcccatgcttctaggtaccgacctgtgttctctaaaaccatacgttgat
agattcgcattctctgtcatttgggaattggatgatagtgctaatattgtaaatgttaat
tttatgaaatccgtcatcagatctagagaagctttctcatacgaacaagcacaactgaga
attgatgacaaaacccaaaatgatgaattaacgatgggtatgagggctctcttgaaattg
tctgtaaaactgaagcaaaagagactagaggcaggtgccttgaacttagcttctcctgag
gttaaggtccatatggatagtgagacttcagatccaaatgaagtggaaatcaaaaaatta
ctggcgacaaattctttagttgaagaatttatgttgttggctaatatatcagtggcaagg
aagatatacgatgccttccctcaaacggcgatgctaagaagacacgcagctccgccatct
accaattttgaaatcttaaatgaaatgttaaacacaagaaagaatatgtcaatttcgttg
gaatcgtccaaggccttggccgattctttagacaggtgtgtggatcccgaagatccatat
tttaatacattggttcgtatcatgtcgactcgctgtatgatggcagcccaatacttttat
tctggagcttattcttatcctgactttagacactatggtttagccgttgatatctacaca
catttcacatcacctattagacgttactgtgatgttgtggcccatagacaattagcaggt
gccattgggtatgaacccctaagtttgactcatcgtgataagaataaaatggacatgatt
tgcagaaatatcaacagaaagcacagaaacgcccaattcgccggtagggcaagcatagaa
tactatgtcgggcaagtaatgaggaataacgagtccacagaaactggatatgttattaag
gtatttaataatggtatagtcgtactggttcccaagtttggcgtggaaggcttgataaga
ctggataatttgactgaggatcctaactcagccgcttttgatgaggtggaatacaaatta
acctttgtgcctacaaattcagataaaccgagggatgtttacgttttcgataaggtcgaa
gttcaagttaggtcggtgatggatccaattactagcaagcgtaaggcagaattattgtta
aaatag

DBGET integrated database retrieval system