KEGG   Saccharomyces cerevisiae (budding yeast): YOL043CHelp
Entry
YOL043C           CDS       T00005                                 

Gene name
NTG2, SCR2
Definition
(RefSeq) bifunctional N-glycosylase/AP lyase NTG2
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    YOL043C (NTG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOL043C (NTG2)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     YOL043C (NTG2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     YOL043C (NTG2)
 Prokaryotic Type
     YOL043C (NTG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD HHH
Motif
Other DBs
NCBI-GeneID: 854114
NCBI-ProteinID: NP_014599
SGD: S000005403
UniProt: Q08214
Position
XV:complement(248392..249534)
Genome map
AA seq 380 aa AA seqDB search
MREESRSRKRKHIPVDIEEVEVRSKYFKKNERTVELVKENKINKDLQNYGGVNIDWIKAL
KPIEYFEWIESRTCDDPRTWGRPITKEEMINDSGAKVPESFLPIYNRVRLMRSKVKTPVD
AMGCSMIPVLVSNKCGIPSEKVDPKNFRLQFLIGTMLSAQTRDERMAQAALNITEYCLNT
LKIAEGITLDGLLKIDEPVLANLIRCVSFYTRKANFIKRTAQLLVDNFDSDIPYDIEGIL
SLPGVGPKMGYLTLQKGWGLIAGICVDVHVHRLCKMWNWVDPIKCKTAEHTRKELQVWLP
HSLWYEINTVLVGFGQLICMARGKRCDLCLANDVCNARNEKLIESSKFHQLEDKEDIEKV
YSHWLDTVTNGITTERHKKK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggaaagtaggtctaggaagagaaagcatattcctgttgatattgaagaggta
gaagttcgatctaagtatttcaaaaagaatgagagaactgttgagttagtaaaagaaaat
aaaatcaataaagatttgcaaaattacggcggagtaaatattgactggatcaaggcactg
aagccaatagagtattttgaatggatcgaatcaaggacttgtgatgatccgagaacttgg
ggacggccaataactaaagaagaaatgattaacgattctggggcgaaagttcctgagagt
ttcttacccatatataatcgggtgagattaatgaggtccaaggttaaaaccccggtagat
gctatgggatgtagcatgattcctgttttagtttctaataaatgtgggatacctagtgaa
aaagtcgatccaaagaatttcaggcttcaatttcttattggcactatgctttctgctcaa
acgagggacgaaaggatggcgcaagcggctttgaatatcaccgaatactgcttaaacaca
ttaaaaatagcagagggtattacgctagatggactgcttaaaattgatgaacctgtatta
gcaaatctaattcgatgcgttagcttctataccagaaaagccaatttcatcaaaagaacc
gcacaattattggtagacaatttcgattcagatataccgtatgatatagagggaattctc
tcgttacctggagttggacctaaaatgggatatttaacactgcaaaaaggttgggggctg
attgccggcatatgcgtcgatgttcatgtccataggctgtgtaaaatgtggaattgggta
gaccctattaagtgtaagactgccgagcatactagaaaggagttacaggtttggctacct
cactcactgtggtacgaaataaacaccgttttggttggatttggtcaattgatctgcatg
gccaggggtaagaggtgtgatttatgtctagcaaacgatgtctgcaatgctcgcaatgag
aagctaatcgaatcttccaaatttcatcaattggaggacaaagaagacatcgagaaagta
tattcgcattggttggacacggttacaaatggaattacaacagaaagacacaagaaaaaa
tag

DBGET integrated database retrieval system