KEGG   Saccharomyces cerevisiae (budding yeast): YOL051WHelp
Entry
YOL051W           CDS       T00005                                 

Gene name
GAL11, ABE1, MED15, RAR3, SDS4, SPT13
Definition
(RefSeq) Gal11p
  KO
K15158  mediator of RNA polymerase II transcription subunit 15, fungi type
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YOL051W (GAL11)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     YOL051W (GAL11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gal11_ABD1 Med15_fungi KIX_2
Motif
Other DBs
NCBI-GeneID: 854106
NCBI-ProteinID: NP_014591
SGD: S000005411
UniProt: P19659
Structure
PDB: 

Position
XV:234940..238185
Genome map
AA seq 1081 aa AA seqDB search
MSAAPVQDKDTLSNAERAKNVNGLLQVLMDINTLNGGSSDTADKIRIHAKNFEAALFAKS
SSKKEYMDSMNEKVAVMRNTYNTRKNAVTAAAANNNIKPVEQHHINNLKNSGNSANNMNV
NMNLNPQMFLNQQAQARQQVAQQLRNQQQQQQQQQQQQRRQLTPQQQQLVNQMKVAPIPK
QLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARLQQQQAQAQ
AQANNNNNGLPQNGNINNNINIPQQQQMQPPNSSANNNPLQQQSSQNTVPNVLNQINQIF
SPEEQRSLLQEAIETCKNFEKTQLGSTMTEPVKQSFIRKYINQKALRKIQALRDVKNNNN
ANNNGSNLQRAQNVPMNIIQQQQQQNTNNNDTIATSATPNAAAFSQQQNASSKLYQMQQQ
QQAQAQAQAQAQAQAQAQAQAQAAQAAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AHAQHQPSQQPQQAQQQPNPLHGLTPTAKDVEVIKQLSLDASKTNLRLTDVTNSLSNEEK
EKIKMKLKQGQKLFVQVSNFAPQVYIITKNENFLKEVFQLRIFVKEILEKCAEGIFVVKL
DTVDRLIIKYQKYWESMRIQILRRQAILRQQQQMANNNGNPGTTSTGNNNNIATQQNMQQ
SLQQMQHLQQLKMQQQQQQQQQQQQQQQQQQQQQQQHIYPSSTPGVANYSAMANAPGNNI
PYMNHKNTSSMDFLNSMENTPKVPVSAAATPSLNKTINGKVNGRTKSNTIPVTSIPSTNK
KLSISNAASQQPTPRSASNTAKSTPNTNPSPLKTQTKNGTPNPNNMKTVQSPMGAQPSYN
SAIIENAFRKEELLLKDLEIRKLEISSRFKHRQEIFKDSPMDLFMSTLGDCLGIKDEEML
TSCTIPKAVVDHINGSGKRKPTKAAQRARDQDSIDISIKDNKLVMKSKFNKSNRSYSIAL
SNVAAIFKGIGGNFKDLSTLVHSSSPSTSSNMDVGNPRKRKASVLEISPQDSIASVLSPD
SNIMSDSKKIKVDSPDDPFMTKSGATTSEKQEVTNEAPFLTSGTSSEQFNVWDWNNWTSA
T
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctcctgtccaagacaaagacactctgtccaatgccgagcgtgcgaagaac
gtcaacgggttgcttcaggtgctcatggacattaacactctgaacggagggagctccgac
actgctgataagataagaattcatgccaaaaacttcgaggcagctttgttcgcaaagagc
tcttcaaagaaagaatacatggacagcatgaacgaaaaagttgctgtcatgcgcaacacg
tacaatacgaggaaaaacgccgttactgctgctgccgctaataacaacattaaacccgtg
gaacagcaccatattaacaacttgaaaaattctggcaacagcgccaataatatgaatgtc
aatatgaatctaaacccacagatgttcttgaatcagcaggctcaggcaaggcaacaggtt
gcgcaacaattaagaaatcaacaacaacaacaacaacagcagcagcagcaacagaggcgt
caattgactcctcaacaacaacaattagtgaaccagatgaaagtggcacctattcccaaa
caattactgcaaagaattcctaacattccacccaatatcaacacctggcagcaggtcact
gctttggctcaacaaaagctattgacacctcaggatatggaagctgcgaaggaagtctac
aagattcaccagcagttgctattcaaagcaaggctacagcaacaacaagcacaggctcaa
gcacaagctaataacaacaacaacggcctcccccaaaatggtaatattaacaataacata
aatattcctcaacagcagcaaatgcaacctcccaattcaagtgcgaacaacaaccctttg
caacagcaatcatcacaaaataccgtaccaaacgtcctcaaccaaattaaccaaatcttt
tctccagaggagcaacgcagcttattacaagaagccatcgaaacctgcaagaattttgaa
aaaacacaattgggtagtacgatgacggaacctgtcaagcaaagttttattaggaaatac
attaaccaaaaggccctgagaaaaatccaagctttgagagatgttaagaacaacaataac
gctaacaacaacggctcgaaccttcagagagcccaaaatgtccctatgaatatcatccaa
caacaacaacaacagaacacgaacaataatgacaccattgccacttctgctacacctaat
gctgccgctttctctcagcaacagaacgcaagttctaaattatatcagatgcaacaacag
caacaagctcaagctcaagctcaagctcaagctcaggcacaggctcaagcacaagctcaa
gcacaggcggcacaagcggcgcaagcgcaagcacaagcacaagcacaagcacaagcacag
gcacaggcacaggcacaagcccaggcgcaggcccaagcccaagcccaagcacaagcacaa
gcacacgctcagcaccagccctcccaacaaccacaacaagctcagcaacaacctaaccca
ctacatgggttgacacctactgcaaaggatgtcgaagtaattaagcaattgtccttggat
gcttctaagaccaacctaaggcttacggacgtaacaaattctttatccaatgaagaaaag
gaaaaaattaaaatgaagttaaagcaaggtcaaaagctttttgttcaggtgagtaatttc
gccccacaagtctacatcatcacaaagaatgaaaacttcttgaaggaagtttttcagtta
agaatctttgtaaaagagatcctagaaaaatgtgccgagggtatatttgttgttaaatta
gacaccgttgacaggttaattattaagtatcaaaaatattgggaaagtatgagaattcaa
attttaagaagacaagctattttaagacaacaacagcaaatggcaaacaacaatgggaac
ccaggcactacttctactggaaacaataataatattgcaactcagcaaaatatgcaacag
tcactacagcaaatgcagcatttacagcaattgaaaatgcagcagcaacaacaacagcag
caacaacaacagcagcaacaacaacagcagcaacaacaacagcaacagcacatatatccc
tcctcgactcctggtgtggctaattattcggcaatggctaatgcacccggtaacaatatc
ccatatatgaaccataaaaatacctctagcatggattttttgaactctatggaaaataca
ccaaaagttcccgtatccgctgcggcaaccccatcactgaacaagacgatcaacggtaag
gtgaatggcaggacaaaatctaatacgatacctgttaccagcattccatcaacaaataag
aaactatcaatttcaaatgccgctagtcaacaacccactcctaggtctgcatcaaatacc
gctaagtcaaccccaaatacaaatccttctccactgaaaacccaaactaaaaatggcaca
ccaaaccccaataatatgaagactgtacagtctcctatgggtgcacaaccatcatataat
agtgccattatagagaatgcattcagaaaggaagaactcttgttaaaagatttggaaatc
aggaagttggagatatcttctcgttttaaacatcgccaagaaattttcaaagattctcct
atggatttgtttatgagtacgctgggtgattgcttaggtatcaaagatgaagagatgctt
acgtcatgcactatcccaaaggctgtggttgatcacatcaacggctctggcaaaaggaag
cctacaaaagcggctcaaagggctcgcgatcaagattccattgacatttccataaaagac
aacaaattggttatgaagagtaaattcaataagagcaataggtcgtattcgatagcgttg
tccaatgtagctgctatattcaagggtatcggtggtaactttaaagacttgtccactttg
gttcattcatcatcgccgtccacatcttctaatatggatgtcggcaacccaagaaaaaga
aaagccagcgtattagaaataagcccgcaagattcgatagcctcggtgctatcaccagat
tcaaatataatgagtgattctaaaaaaattaaagtagattctcctgatgacccattcatg
acaaaatcaggagccacaactagtgaaaaacaagaagtaacaaatgaagctccattttta
acttctgggactagttcagaacaattcaatgtatgggattggaataattggacaagtgct
acttga

DBGET integrated database retrieval system