KEGG   Saccharomyces cerevisiae (budding yeast): YOL052CHelp
Entry
YOL052C           CDS       T00005                                 

Gene name
SPE2
Definition
(RefSeq) adenosylmethionine decarboxylase SPE2
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce00330  Arginine and proline metabolism
sce01100  Metabolic pathways
Module
sce_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YOL052C (SPE2)
   00330 Arginine and proline metabolism
    YOL052C (SPE2)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     YOL052C (SPE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAM_decarbox
Motif
Other DBs
NCBI-GeneID: 854105
NCBI-ProteinID: NP_014590
SGD: S000005412
UniProt: P21182
Position
XV:complement(232446..233636)
Genome map
AA seq 396 aa AA seqDB search
MTVTIKELTNHNYIDHELSATLDSTDAFEGPEKLLEIWFFPHKKSITTEKTLRNIGMDRW
IEILKLVKCEVLSMKKTKELDAFLLSESSLFVFDHKLTMKTCGTTTTLFCLEKLFQIVEQ
ELSWAFRTTQGGKYKPFKVFYSRRCFLFPCKQAAIHQNWADEVDYLNKFFDNGKSYSVGR
NDKSNHWNLYVTETDRSTPKGKEYIEDDDETFEVLMTELDPECASKFVCGPEASTTALVE
PNEDKGHNLGYQMTKNTRLDEIYVNSAQDSDLSFHHDAFAFTPCGYSSNMILAEKYYYTL
HVTPEKGWSYASFESNIPVFDISQGKQDNLDVLLHILNVFQPREFSMTFFTKNYQNQSFQ
KLLSINESLPDYIKLDKIVYDLDDYHLFYMKLQKKI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcaccataaaagaattgactaaccacaactacattgaccacgaactatcagcc
actttagactcaacggatgcgttcgagggtcccgagaagttgctggaaatctggttcttc
cctcacaagaagtccatcacgaccgaaaagacattaagaaatattggcatggatagatgg
atcgagattttgaaattagtgaaatgcgaagttctttccatgaagaagactaaagaactg
gatgcctttttgttgagtgagtcttccctcttcgtcttcgatcacaaattgacgatgaag
acgtgcggtactacaaccacattgttctgtctcgaaaagcttttccagatcgttgagcaa
gagttatcgtgggctttccgcacaacacaagggggcaagtacaaaccatttaaagtgttt
tattctagacgatgtttccttttcccctgtaagcaagccgctatccatcaaaactgggct
gacgaagtcgactatttgaacaaatttttcgacaatggtaaaagttattccgtgggaaga
aatgacaagagcaaccactggaacctgtacgtcaccgagacggaccgctccacacctaag
ggaaaggagtacatcgaggatgacgacgaaactttcgaagtactgatgacggagctggac
ccagaatgcgctagtaagtttgtttgcgggcctgaggcatccacaaccgctctcgtggag
ccaaacgaagataagggccacaacctcggctaccaaatgactaaaaatacaaggcttgac
gaaatatatgtcaactcggcccaagactccgatttatcatttcaccacgatgcatttgcg
ttcacgccatgtggatactcatccaatatgattctcgctgaaaaatactattacaccctg
cacgtgactccggaaaagggttggtcttacgcctctttcgaaagtaacatacccgtattt
gacatttcccaagggaagcaagacaacttggacgttcttctacatattctgaacgttttt
caaccaagagagttctcgatgaccttttttaccaaaaattatcagaaccaatccttccaa
aaactactaagcatcaacgagtcactgcccgactacatcaagttagacaaaattgtttat
gatctggacgactaccaccttttctatatgaaattgcagaagaaaatatga

DBGET integrated database retrieval system