KEGG   Saccharomyces cerevisiae (budding yeast): YOL057WHelp
Entry
YOL057W           CDS       T00005                                 

Definition
(RefSeq) dipeptidyl-peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sce01002]
    YOL057W
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     YOL057W
Peptidases [BR:sce01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   YOL057W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49 Ubiquitin_2 DUF1027
Motif
Other DBs
NCBI-GeneID: 854097
NCBI-ProteinID: NP_014584
SGD: S000005418
UniProt: Q08225
Structure
PDB: 

Position
XV:220767..222902
Genome map
AA seq 711 aa AA seqDB search
MSHFFADHDAPLSMLSVKTEYFPQLTDKEQKYAHFMSKASHAGSRVVMRQVSHESEPIFD
LILAIHSKLNGKYPEDDITQKQQTGLYLEYVSQFLSNLGNFKSFGDTKFIPRCEVKFFKQ
LLELAKINPCSSPLTLSPVDVNHEFTSHHLFSTINELIDIGIYHVEEKAALLGFPSQGYT
SAYYLGLPVTPEDMALLKEQLFAELAILPENTRINKVGENSFQIWVASENVKNQITETYP
SGQITLSNAVTKVEFIFGDHSREMRLVASYLKEAQKFAANDTQKAMLQEYINHFVTGSSQ
AHKEAQKLWVKDISPVIETNIGFIETYREPSGIIGEFESLVAIQNKERTAKFSSLVNNAE
EFISLLPWSKDYEKPIFNPPDFTSLEVLTFTGSGIPAGINIPNYDDVRLKIGFKNVSLGN
ILSAAAKSSSKHPPSFISQEDRPIFEKYQSDSFEVQVGIHELLGHGSGKLLTEFTDGFNF
DKENPPLGLDGKPVSTYYKVGETWGSKFGQLAGPFEECRAEVIAMFLLTNKKILDIFGFH
DVESQDKVIYAGYLQMARAGLLALEYWNPKTGKWGQPHMQARFSIMKTFMKHSTDKNFLK
LEMNSTNDDFAIKLDKSLIKTAGHECVKDYLKHLHVYKCSGDVEQGSKYFIDRSTVTPDL
ASLRDIVLSKRLPRRQFIQSNSYIDDNNKVTLKEYDETPQGMLQSFLDREL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagccactttttcgccgatcatgatgctcctctgagcatgctttctgttaaaacagaa
tactttcctcaattgactgataaggaacaaaaatatgcgcatttcatgtcaaaggcctcc
catgcgggttcaagggttgtaatgagacaagtttctcatgagagtgagccaatttttgac
ctaatccttgccattcattcaaagctaaacggcaagtacccagaggacgatattacgcag
aagcagcaaacgggtttgtatttggaatacgtttctcaattcttatctaatttgggtaat
ttcaaatcgtttggtgacactaagtttattcctcgttgtgaggtaaaattcttcaaacag
cttttggagctggccaagattaatccgtgttcttctccgctcactttatctcctgttgac
gttaaccatgaattcacatctcatcatcttttttccaccatcaatgagctaattgatatt
ggtatttaccatgtggaagagaaggcggctctcttagggtttccctctcaaggttatact
tcagcctattatctgggtttacctgtgacacctgaagatatggctcttttgaaagagcag
ttgtttgctgaacttgccatcttgcctgaaaacacaagaatcaacaaagttggtgaaaac
agtttccaaatctgggttgcctctgagaatgtgaaaaaccagataacagaaacctacccc
agtggacagatcacattatccaatgctgtaaccaaagtagaattcatttttggtgatcat
tcacgtgaaatgcgtttagtagcatcgtatttaaaggaagctcaaaaattcgcggctaat
gatactcaaaaagcaatgcttcaggaatacatcaaccactttgtcactggctcttctcaa
gcacataaagaagcacaaaaactttgggtcaaagatatatctcccgtcattgaaacaaat
atcggttttatcgaaacatatagagaaccctcgggcataattggagaatttgaatcgttg
gttgcaattcaaaacaaagaacgtactgctaaattttccagcttggttaacaacgcagaa
gaattcatttccttactaccatggtctaaagattacgaaaaaccgattttcaatccacca
gatttcacctctctagaagtattaacgtttactggatcgggtataccagcgggcatcaat
attccaaactatgatgatgttcggcttaaaattgggttcaagaatgtttctttggggaat
atcttaagcgcggctgccaaaagctcatccaagcatccgccaagttttatatcgcaagaa
gatcgcccaatttttgaaaaatatcaaagtgattcttttgaagtccaagtaggcatccat
gaattattaggacatggttcaggaaagttgttgacagaatttacagacggctttaatttt
gataaggaaaaccctcctttaggtttggatgggaaaccggtgagcacatactacaaagtt
ggtgaaacttggggttccaaatttggacagttagctggcccatttgaagaatgtcgtgcg
gaagtaattgccatgtttttgcttactaataagaagattcttgatatttttggtttccat
gatgtcgaatctcaagataaagtgatctacgctggatatctacaaatggcccgtgcgggt
ctcctagctttagaatactggaatccaaaaactggtaagtggggacaaccacacatgcaa
gcaagattttctatcatgaaaacatttatgaagcactctacagataagaatttcttaaag
ttggagatgaacagcacgaatgatgattttgccatcaagttggataaatctctcattaaa
acagcgggacatgaatgtgtgaaagactatttaaagcatttgcatgtttacaaatgttca
ggcgatgtggaacagggaagtaagtactttattgatagatcaacggtgacaccggatttg
gcgtctttaagagacatcgtcttatctaagagattgccaaggagacaattcatacaatcg
aattcttatattgacgacaataacaaggtaaccctgaaagaatatgatgaaaccccacag
ggtatgctccaatctttccttgatagagaattatga

DBGET integrated database retrieval system