KEGG   Saccharomyces cerevisiae (budding yeast): YOL058WHelp
Entry
YOL058W           CDS       T00005                                 

Gene name
ARG1, ARG10
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00220  Arginine biosynthesis
sce00250  Alanine, aspartate and glutamate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01230  Biosynthesis of amino acids
Module
sce_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YOL058W (ARG1)
   00220 Arginine biosynthesis
    YOL058W (ARG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YOL058W (ARG1)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     YOL058W (ARG1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YOL058W (ARG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 854096
NCBI-ProteinID: NP_014583
SGD: S000005419
UniProt: P22768
Position
XV:219211..220473
Genome map
AA seq 420 aa AA seqDB search
MSKGKVCLAYSGGLDTSVILAWLLDQGYEVVAFMANVGQEEDFDAAKEKALKIGACKFVC
VDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDVAKQEGCFAVSHGCTGK
GNDQIRFELSFYALKPDVKCITPWRMPEFFERFAGRKDLLDYAAQKGIPVAQTKAKPWST
DENQAHISYEAGILEDPDTTPPKDMWKLIVDPMDAPDQPQDLTIDFERGLPVKLTYTDNK
TSKEVSVTKPLDVFLAASNLARANGVGRIDIVEDRYINLKSRGCYEQAPLTVLRKAHVDL
EGLTLDKEVRQLRDSFVTPNYSRLIYNGSYFTPECEYIRSMIQPSQNSVNGTVRVRLYKG
NVIILGRSTKTEKLYDPTESSMDELTGFLPTDTTGFIAIQAIRIKKYGESKKTKGEELTL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggaaaagtttgtttggcttattctggtggtttagatacctccgtcattttg
gcttggctactagaccaaggctacgaagttgtagctttcatggctaatgtagggcaagaa
gaagatttcgatgccgccaaggaaaaggccttgaagatcggtgcctgcaagttcgtttgt
gtggattgtcgtgaagattttgtcaaggatattctattcccagctgtacaggtcaacgct
gtgtacgaagacgtttatctgttgggtacctctttggcaagacctgttattgccaaagcc
caaattgacgtcgctaaacaggagggctgtttcgcggtctctcatggttgtaccggtaaa
ggtaatgatcaaatcagattcgaattgtcattttacgctctgaagccagacgttaagtgt
attacaccatggagaatgcctgaatttttcgaaagatttgctggcagaaaggatttgtta
gactatgctgcacaaaagggtattcccgtcgcccaaaccaaggccaagccatggtctact
gacgaaaaccaagcccacatttcttacgaggcaggtatcttggaagacccagataccacc
ccaccaaaggacatgtggaaattgatcgtcgatccaatggatgctccggaccaaccacaa
gatttgaccattgactttgaacgtggtcttccagtcaagttgacctacaccgacaacaag
acttccaaggaagtttccgttaccaagcctttggatgttttcttggccgcatccaactta
gcaagggccaacggtgttggtagaatcgatattgtagaagatcgttacattaacttgaaa
tccagaggttgttacgaacaggctccattgactgttttgagaaaagctcatgttgatttg
gaaggtttgactttagacaaagaagtccgtcaattgagagactcattcgtcacaccaaac
tactccagattgatatataacggttcctacttcaccccagagtgtgagtacatcagatct
atgatccaaccatcccaaaatagcgttaacggtactgtcagggttagactgtataagggt
aacgtcatcattctgggcagatctacaaagactgaaaagttgtacgatccgacagaatcc
tctatggatgagttgaccggtttcttacctaccgataccaccggtttcattgccatccag
gccattagaattaaaaaatacggtgaatccaaaaaaaccaaaggtgaagagttgactttg
taa

DBGET integrated database retrieval system