KEGG   Saccharomyces cerevisiae (budding yeast): YOL059WHelp
Entry
YOL059W           CDS       T00005                                 

Gene name
GPD2, GPD3
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase (NAD(+)) GPD2
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00564  Glycerophospholipid metabolism
sce01110  Biosynthesis of secondary metabolites
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YOL059W (GPD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YOL059W (GPD2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     YOL059W (GPD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C
Motif
Other DBs
NCBI-GeneID: 854095
NCBI-ProteinID: NP_014582
SGD: S000005420
UniProt: P41911
Position
XV:217126..218448
Genome map
AA seq 440 aa AA seqDB search
MLAVRRLTRYTFLKRTHPVLYTRRAYKILPSRSTFLRRSLLQTQLHSKMTAHTNIKQHKH
CHEDHPIRRSDSAVSIVHLKRAPFKVTVIGSGNWGTTIAKVIAENTELHSHIFEPEVRMW
VFDEKIGDENLTDIINTRHQNVKYLPNIDLPHNLVADPDLLHSIKGADILVFNIPHQFLP
NIVKQLQGHVAPHVRAISCLKGFELGSKGVQLLSSYVTDELGIQCGALSGANLAPEVAKE
HWSETTVAYQLPKDYQGDGKDVDHKILKLLFHRPYFHVNVIDDVAGISIAGALKNVVALA
CGFVEGMGWGNNASAAIQRLGLGEIIKFGRMFFPESKVETYYQESAGVADLITTCSGGRN
VKVATYMAKTGKSALEAEKELLNGQSAQGIITCREVHEWLQTCELTQEFPLFEAVYQIVY
NNVRMEDLPEMIEELDIDDE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgtcagaagattaacaagatacacattccttaagcgaacgcatccggtgtta
tatactcgtcgtgcatataaaattttgccttcaagatctactttcctaagaagatcatta
ttacaaacacaactgcactcaaagatgactgctcatactaatatcaaacagcacaaacac
tgtcatgaggaccatcctatcagaagatcggactctgccgtgtcaattgtacatttgaaa
cgtgcgcccttcaaggttacagtgattggttctggtaactgggggaccaccatcgccaaa
gtcattgcggaaaacacagaattgcattcccatatcttcgagccagaggtgagaatgtgg
gtttttgatgaaaagatcggcgacgaaaatctgacggatatcataaatacaagacaccag
aacgttaaatatctacccaatattgacctgccccataatctagtggccgatcctgatctt
ttacactccatcaagggtgctgacatccttgttttcaacatccctcatcaatttttacca
aacatagtcaaacaattgcaaggccacgtggcccctcatgtaagggccatctcgtgtcta
aaagggttcgagttgggctccaagggtgtgcaattgctatcctcctatgttactgatgag
ttaggaatccaatgtggcgcactatctggtgcaaacttggcaccggaagtggccaaggag
cattggtccgaaaccaccgtggcttaccaactaccaaaggattatcaaggtgatggcaag
gatgtagatcataagattttgaaattgctgttccacagaccttacttccacgtcaatgtc
atcgatgatgttgctggtatatccattgccggtgccttgaagaacgtcgtggcacttgca
tgtggtttcgtagaaggtatgggatggggtaacaatgcctccgcagccattcaaaggctg
ggtttaggtgaaattatcaagttcggtagaatgtttttcccagaatccaaagtcgagacc
tactatcaagaatccgctggtgttgcagatctgatcaccacctgctcaggcggtagaaac
gtcaaggttgccacatacatggccaagaccggtaagtcagccttggaagcagaaaaggaa
ttgcttaacggtcaatccgcccaagggataatcacatgcagagaagttcacgagtggcta
caaacatgtgagttgacccaagaattcccattattcgaggcagtctaccagatagtctac
aacaacgtccgcatggaagacctaccggagatgattgaagagctagacatcgatgacgaa
tag

DBGET integrated database retrieval system