KEGG   Saccharomyces cerevisiae (budding yeast): YOL060CHelp
Entry
YOL060C           CDS       T00005                                 

Gene name
MAM3
Definition
(RefSeq) Mam3p
  KO
K16302  metal transporter CNNM
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOL060C (MAM3)
Transporters [BR:sce02000]
 Other Transporters
  Others
   YOL060C (MAM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CBS
Motif
Other DBs
NCBI-GeneID: 854094
NCBI-ProteinID: NP_014581
SGD: S000005421
UniProt: Q12296
Position
XV:complement(214017..216137)
Genome map
AA seq 706 aa AA seqDB search
MSFLPLRSRSRSGAPHWVYIILYHIFTIPKIYSLPLLSGSHVLNSRDVADSGHSVGDEAS
VTTYYIISIILVLLGGVFAGLTLGLMGQDEVYLKVISTSGSNSEKKLAKRVLDLISRGKH
WVLVTLLLSNVITNETLPIVLDRCLGGGWQAVVSSTILIVIFGEIIPQSVCVKYGLQVGA
FFCPFVLVLMYLMYPVAYPIATLLDYMLGEDHGTMYKKSGLKTLVTLHRTMGVERLTKDE
VTIISAVLDLKAKRVEEIMTPIENVFTMSADTILDDKTVEKIFNSGFSRIPIFLPNEPNN
FIGMLLVRVLISYDPDDCLPISHFPLATLPETSPNTSCLNILNYFQEGKAHMCVVSKEPG
SSHGAIGVLTLEDVIEELIGEEIVDESDVFVDMHQHIMRQQPGPLSKRHITSYLHHLYTS
SHKEHKAADQADESSPLLSPSNSNHPSEHPQQDLNNKSWKQKSNDGYDRSNAVLSPTPQV
TEHGTIIPSNLASNPLNVNKSFVTIKKPANVPKIITTHTPHSSKEPSPAPHSNDKSLSAE
EQQLLSDHAELSRQAVLHTQRSGQPTQVTTSTKTTRNSPDSISIPNSGANHGNENQNVTI
STSYQNTKNGIVESVITVKGVPKTIIGPAKDWDESKSEYGNENINQENSNRSDDRESSSS
NASLFSSIKNKFKNENANNNDRSNFTDSLSRTSNYDANGSSSTIKR
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttttgccactaaggtctaggtcacgatcaggcgctcctcattgggtatacatc
atcttatatcacatctttacgataccgaagatatattcactgccgttgttatccggatca
cacgtactcaattctagggatgttgccgattccggccatagcgtaggtgatgaggcaagc
gttaccacgtactatattatctctatcatcctagtgctgctgggtggtgtatttgcagga
ttgacgctggggttgatgggtcaagatgaagtctacctgaaggtaatcagcacttcaggc
tcgaattctgaaaagaaactggccaagcgggtgcttgacctaatatctagggggaagcat
tgggttctagtcacactgctgctttctaatgttataaccaacgaaacattgcctattgtt
ttggacaggtgtcttgggggtggttggcaggctgtagtgtcgtcaactattctaattgtg
atcttcggtgaaattattccgcagagtgtctgtgttaaatacgggctgcaagttggggca
ttcttctgcccctttgttcttgtactgatgtatctgatgtacccagtcgcatatccgatc
gcgactctcctggactatatgctgggtgaagatcatggtacgatgtacaaaaaatccggc
ttaaagactttggtcaccttgcataggaccatgggggtggaacggttgactaaagacgaa
gttacaatcatctctgctgttttggatctaaaggcaaagagggttgaggaaatcatgact
ccgattgaaaacgtgttcacaatgagtgccgataccatcctagacgataaaactgtcgaa
aaaatcttcaactcagggttttctagaatcccgatttttttgcccaatgaaccaaacaac
ttcatcggcatgttacttgtcagggtgcttatctcctacgatcctgatgactgcctccca
atctcccacttccccctagccacgttgccagaaacttccccgaacacatcttgtttgaat
attctgaattacttccaggaggggaaagctcacatgtgcgtcgttagtaaagagccgggc
tcctcgcatggcgctattggtgttttaactttggaggatgtcattgaagaattgatcggt
gaagaaatcgtggacgagtctgatgtctttgtggacatgcatcagcatattatgagacaa
caaccggggcccttgagcaaaaggcacattacttcctatttgcatcatttgtacactagc
tctcacaaggagcacaaagctgctgaccaagctgatgaatcgtctccactcttgtctcca
tccaattctaatcacccatccgagcacccacagcaagatttgaataataagtcttggaag
cagaagtcaaatgatggttacgacaggtccaacgctgtattgtctccaactccacaagtg
acggaacatggcaccatcataccttcaaatctagcgtccaacccgttgaacgtaaataaa
tcttttgttaccattaaaaagcctgccaatgttccgaaaatcattactacacacactcct
cattctagcaaagagccttctccagcaccacactcaaatgataaatcactctccgccgaa
gaacaacaactattaagtgatcatgcagagctatctcgccaagctgttctccatactcaa
cggtcgggtcaaccaactcaagttactacctcgactaaaaccacgagaaatagccctgat
agtatatcaattccaaattctggcgcgaatcacggcaacgaaaatcaaaacgttacaatc
tcaacctcttaccaaaatacgaagaatggtattgtggaatctgtcatcacagtcaaaggt
gttccaaaaaccatcattggccccgcaaaagattgggacgaatccaaaagtgaatatgga
aacgagaatatcaatcaagagaattctaatcgaagtgacgatagagaaagttcaagttca
aatgcaagtttattttccagtattaagaataaatttaagaacgaaaacgctaacaacaat
gatcgttctaatttcaccgactctttgtcaagaacttccaattatgatgccaacggctcc
tcgtcgaccataaaaagatga

DBGET integrated database retrieval system