KEGG   Saccharomyces cerevisiae (budding yeast): YOL061WHelp
Entry
YOL061W           CDS       T00005                                 

Gene name
PRS5
Definition
(RefSeq) ribose phosphate diphosphokinase subunit PRS5
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00030  Pentose phosphate pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YOL061W (PRS5)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YOL061W (PRS5)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     YOL061W (PRS5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyl_synth Pribosyltran_N Pribosyltran
Motif
Other DBs
NCBI-GeneID: 854093
NCBI-ProteinID: NP_014580
SGD: S000005422
UniProt: Q12265
Position
XV:212244..213734
Genome map
AA seq 496 aa AA seqDB search
MSMSNIVVFGGDSHPELVTKICENLDIHPSKVELGKFSNGETNIALRESVREKDVYIIQS
GCGQVNDTFMQLLILISACKSASASRVTAVMPYLCYSRQPDIPYTAKGAPIISKPKENYT
FESHPGTPVSSSLMTQRPGAESSLKSLDSAIRSTINLENPQPIRTPNSSATANNNFDIKK
TLSFSRIPMIPGGKLQNTSNSTDAGELFNAQNAGYKLWVVQAGTLIAHLLSAAGADHVIT
MDLHDPQFPGFFDIPVDNLYCKPIAQNYIQHRIPDYQDAVIVSPDAGGAKRATAIADALE
LSFALIHKERRSQLLKGPPDATLTSGGSLPVSPRPLVTTLVSSQNTTSSGATGVAALEMK
KTTSTSSTSSQSSNSSKFVQTTMLVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGSTK
VYALITHGVFSGDALERIGQSSIDKLIISNTVPQDRTLQYLGKDRVDVIDVSCIIGEAIR
RIHNGESISMLFEHGW
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgagtaatattgttgtttttggaggggactcgcaccccgagttagttactaag
atctgtgaaaatttggacattcacccatcgaaagtagaattagggaagttttctaatggg
gaaacgaacattgctcttcgcgaatctgttcgtgaaaaggatgtatatatcatccagagt
ggttgtggccaggtgaacgacacgttcatgcagttgctgattttaatcagtgcctgcaag
tccgcttctgcctcgagggttacagccgtaatgccatatctctgctactcgagacagcca
gatattccatatactgccaagggtgctcccataatttccaagcctaaagaaaactatact
tttgaatcgcatccaggcacacccgtgtcatcttctttaatgacgcaaagaccaggtgct
gagagctcgttgaagagtttggatagtgcaatacgatcaactatcaacttagaaaatcct
caacctatcagaacaccaaacagcagtgctacggcgaataacaatttcgacatcaagaag
acgctttctttttcaagaattcctatgattcccggtggtaagttacaaaatacaagcaat
agcacggacgctggtgaattgttcaacgctcaaaatgcaggctataagctatgggtagta
caagccggtactttgattgctcatttgttgagtgctgcaggtgctgaccatgtgatcaca
atggatttgcacgatccacagttccctgggttttttgacattccagtggataatctctac
tgtaaacccattgcacaaaactacatccagcatcgcattccagattatcaggatgctgtg
atcgtttctccagatgctggtggtgcaaagagagctacggctattgcagacgccttggaa
ttgtccttcgccctaattcataaagaaagaagatctcagttattgaagggccctccagat
gcgacgttaacctctggtggttcgttaccagtatctccaaggccattagttactactttg
gtttcctcccaaaatactacttcttcaggtgccactggggttgcggcccttgaaatgaag
aaaacaacttcaacatcttccacctcgtcgcaatcttctaattcgtccaagttcgttcaa
actaccatgcttgttggcgatgttagaaacaaggtgtgtattatagtcgacgacttggtg
gatacttcatacactattacaagagctgcgaaattgttgaaggatcaaggatctaccaaa
gtttatgccttaataacgcacggtgttttttccggtgatgcgctagaaagaatcggccaa
agtagtatagataagttgatcatttctaacacggttcctcaagatagaacactacagtac
ctaggtaaggacagagtggatgttattgatgtctcctgcataatcggtgaagcaattaga
agaatccataacggtgaatccatttctatgttgttcgagcatggatggtag

DBGET integrated database retrieval system