KEGG   Saccharomyces cerevisiae (budding yeast): YOL062C
Entry
YOL062C           CDS       T00005                                 

Gene name
APM4, AMP1
Definition
(RefSeq) Apm4p
  KO
K11826  AP-2 complex subunit mu-1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YOL062C (APM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOL062C (APM4)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    YOL062C (APM4)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 854092
NCBI-ProteinID: NP_014579
SGD: S000005423
UniProt: Q99186
Position
XV:complement(210520..211995)
AA seq 491 aa
MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR
HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN
GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS
SFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTID
ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLEDC
KFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRI
TLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT
LSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY
ISKAGSYEVRY
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgattagtggtgtgctggtatactcatcgagaggtgaacttgtcttgaacaagttcttc
aagaactcgttgaagcggtccatatccgatatcttccgagtacaagtgatcaataatcta
gatgttagatcgcctgttttgacactgggctcaactactttccatcacatcaggtcgagg
catggtgacaatttgtggttggtaaccattacgagaagcaacgctaatagtgcggcgatc
tgggagttcttatataagcttgatgcagtgatgaatgcttatcgattggatagagaggag
gccttgaaagaggaattcatgattgtgcatgagatgctggatataatgttgggtggaaat
gggataccaattgacactgaattgaactctgttatagcgcagatgtctgtgaaacccgtt
agaaatatgggcggattgttagatagtcccgatggaaatgatgtattatcttcctcttca
tctcctacttcttcagcaggagaactacattttcccaaatttttgacaaaaagaagcagt
agtttcctgggtcaaggagactccacttctgatttctatgataacaataagatcacttgg
aggcccaaggggataatacacaagaaggatgaagttttcttgtatgtcaatgagaggata
aacattctggtatctagggatggttctatcttgaaatcatacgttgatggcaccatagat
atcaccacacacttgagtgggacccctatttgtagatttggattgaatgattctttggga
atgcagtccgaagacgagaagaaatggttagcacagcagcagcgtcactctggcagcgat
tttggaaacaagaacttcattcccaaagctgctgccggtagtgttttgttggaagattgc
aagtttcacgaatgtgtctcacttgacaaatttaacagaaatcatatcattgaattcgtc
ccaccagacggttcgatggagttgatgaaatatcatgtacgagataacataaacctgccg
ttcaaggttacacctattgttacacattctacaagagataacgagattgattacaggata
acattgaagtctttatttcctggaaaactttccgccaaagatgtggtactacatataccc
gttccaccaagcactgtggattgtaagataagtgtctctaatggccactgtaagtttgtg
ccagaagaaaatgcaatgatttggaggttcaacaagtacaatgggttgacggaaaacact
ttaagtgcagttactgtgtccacaagtgatactactcaattgaatcttcaacaatggaca
agacctccaatatccctggaattcgaggtcatgatgttcagtaattctggcttagtcgta
cgatactttaccatttctggaaaagacagtaagcatcgtgctgtaaaatggattaaatat
atatcgaaagccggttcttacgaggtgaggtactag

DBGET integrated database retrieval system