KEGG   Saccharomyces cerevisiae (budding yeast): YOL066CHelp
Entry
YOL066C           CDS       T00005                                 

Gene name
RIB2, PUS8
Definition
(RefSeq) bifunctional DRAP deaminase/tRNA pseudouridine synthase RIB2
  KO
K14655  tRNA pseudouridine32 synthase / 2,5-diamino-6-(5-phospho-D-ribitylamino)-pyrimidin-4(3H)-one deaminase [EC:5.4.99.28]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00740  Riboflavin metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    YOL066C (RIB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOL066C (RIB2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     YOL066C (RIB2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    YOL066C (RIB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inv-AAD PseudoU_synth_2 dCMP_cyt_deam_1 MafB19-deam
Motif
Other DBs
NCBI-GeneID: 854088
NCBI-ProteinID: NP_014575
SGD: S000005427
UniProt: Q12362
Position
XV:complement(202696..204471)
Genome map
AA seq 591 aa AA seqDB search
MEDSNNEASDDFNNLLNKEIESAKEVKLRKFANRNNNRNENSSKVKDASGFRLRVIQTDG
HKTKKTDPDYEVTIDGPLRKIEPYFFTYKTFCKERWRDRKLVDVFVSEFRDREPSYYSKT
IAEGKVYLNDEPANLDTIIRDGDLITHKVHRHEPPVTSKPIDIVFEDEDILVIDKPSSIP
VHPTGRYRFNTITKMLERQLGYSVHPCNRLDKPTSGLMFLAKTPLGADRMGDQMKAREVT
KEYVARVKGEFPIGIVEVDKPVRSVNPKVALNAVCEMSDENAKHAKTVFQRVSYDGQTSI
VKCKPLTGRTHQIRVHLQYLGFPIANDPIYSNPDIWGPDLGRGGLQNYDDIVLKLDAIGK
TNPAESWIHPHSEGEYLLGRQCEECEAEMYTDPGTNDLDLWLHAFRYESLERNSDTQKPL
WSYRTKYPEWALEPHRRYMEMAVKEAGKCGPTKTAFSVGAVLVHGTQVLATGYSRELPGN
THAEQCALIKYSQLHPNCPTIVPMGTVLYTTMEPCSFRLSGNEPCCDRILATQGAIGTVF
VGVMEPDTFVKNNTSLNKLESHGVNYIQIPGYEEECTIIAFKGHDNSDDKA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggaggactctaataatgaagccagcgatgacttcaacaacttattaaacaaagaaatt
gagtctgcaaaggaagtgaagttaagaaaattcgcgaacaggaataataataggaacgaa
aacagttccaaagtcaaagatgcgagtggattcagactgagagttattcaaaccgatggg
cacaaaactaaaaagacagaccctgattatgaagtgacaattgatggacccttaaggaag
attgagccttattttttcacttataaaactttctgtaaggagaggtggagagatcgtaag
ttggtggatgtattcgtgagcgaattcagggatcgagagcccagctattattccaaaacc
attgcagagggaaaagtatacttaaacgatgaacctgcaaaccttgataccatcattcgt
gacggtgatctgatcacacataaagtacatcgacatgaaccgccagtcacatctaaacca
atagatattgtgtttgaagacgaagatatccttgtcattgataaacccagcagtattcca
gtgcacccaacgggcagatacagattcaataccattacaaaaatgctagaaagacagcta
ggttattcagtacatccatgtaatagactagacaagccaactagtggactaatgttttta
gccaagactccattaggtgcagatagaatgggagaccaaatgaaagcgagggaagtcacc
aaagaatacgtagcccgcgtgaagggcgagttccctataggtatagtagaggtagataag
cctgtcagatctgttaaccctaaagttgcactaaacgctgtttgcgagatgagcgatgaa
aacgctaaacatgccaagaccgttttccaaagggttagctatgatggacagacgagtatt
gtaaagtgtaaaccattgacaggtagaactcaccaaataagagtccatttgcagtacttg
ggatttcccatagcaaatgaccctatatactcgaacccagatatctggggtccagatttg
ggccgcggtggacttcaaaactatgatgacatcgttctgaaactagacgctattggcaag
actaatcctgcagagagctggattcatcctcatagcgagggtgaatacttgcttggccgt
cagtgcgaagaatgcgaggctgaaatgtacacagatcccggtactaatgatctcgacctc
tggctgcatgccttccggtacgagtcattggaaagaaattcggatacgcaaaaacctctc
tggagttatagaacaaaataccctgaatgggccttagagccacatcgccgatatatggaa
atggccgttaaggaagctggtaagtgtggcccgacaaagactgcttttagtgttggtgcc
gttcttgttcatggaactcaagtacttgccacaggatattcaagagagctaccaggaaac
actcatgcagaacagtgtgctttgataaagtactcgcagttacacccgaactgtcccact
atagtccctatgggaacagtgctctatacaaccatggaaccctgttccttcaggctaagt
ggcaatgagccttgctgcgatagaatcctggccacccaaggtgccattggtactgtcttc
gtgggggttatggagcccgatacatttgttaaaaacaatacaagtttgaacaagctggaa
tcgcacggtgtgaactacatacaaataccaggctacgaggaggagtgcaccatcattgcc
ttcaaaggccacgataatagtgacgacaaagcttag

DBGET integrated database retrieval system