KEGG   Saccharomyces cerevisiae (budding yeast): YOL068CHelp
Entry
YOL068C           CDS       T00005                                 

Gene name
HST1
Definition
(RefSeq) histone deacetylase HST1
  KO
K11121  NAD-dependent histone deacetylase SIR2 [EC:3.5.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YOL068C (HST1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YOL068C (HST1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YOL068C (HST1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YOL068C (HST1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     YOL068C (HST1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    SIR proteins
     YOL068C (HST1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   Sir proteins
    YOL068C (HST1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIR2 DUF592 TPP_enzyme_M DUF3072
Motif
Other DBs
NCBI-GeneID: 854086
NCBI-ProteinID: NP_014573
SGD: S000005429
UniProt: P53685
Position
XV:complement(200368..201879)
Genome map
AA seq 503 aa AA seqDB search
MNILLMQRIVSFILVVSQGRYFHVGELTMTMLKRPQEEESDNNATKKLKTRLTYPCILGK
DKVTGKFIFPAITKDDVMNARLFLKDNDLKTFLEYFLPVEVNSIYIYFMIKLLGFDVKDK
ELFMALNSNITSNKERSSAELSSIHAKAEDEDELTDPLEKKHAVKLIKDLQKAINKVLST
RLRLPNFNTIDHFTATLRNAKKILVLTGAGVSTSLGIPDFRSSEGFYSKIRHLGLEDPQD
VFNLDIFLQDPSVFYNIAHMVLPPENMYSPLHSFIKMLQDKGKLLRNYTQNIDNLESYAG
IDPDKLVQCHGSFATASCVTCHWQIPGEKIFENIRNLELPLCPYCYQKRKQYFPMSNGNN
TVQTNINFNSPILKSYGVLKPDMTFFGEALPSRFHKTIRKDILECDLLICIGTSLKVAPV
SEIVNMVPSHVPQILINRDMVTHAEFDLNLLGFCDDVASLVAKKCHWDIPHKKWQDLKKI
DYNCTEIDKGTYKIKKQPRKKQQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattgctaatgcaacggatagttagttttattttggtggttagtcaagggcga
tactttcatgttggagagctgaccatgacaatgttgaaaagacctcaagaagaagagtca
gataataatgctacgaagaagctgaaaacgagattaacgtacccttgtatcctcgggaag
gataaggtgacgggcaaattcatctttcctgcaatcactaaagatgatgttatgaatgca
agactgtttttgaaggacaacgatttgaaaacttttttagaatattttttgccagtggaa
gtcaactcgatctacatttatttcatgataaaattgctgggattcgacgtcaaagataaa
gaactatttatggcgttaaactctaatatcacttctaataaagaacgttctagtgcggaa
ctatcgtctatacatgcaaaagctgaagatgaggacgagttgaccgatcccttagagaaa
aagcatgcagtaaaattaatcaaagatttacaaaaagccataaataaagtccttagtaca
aggcttcgattacccaacttcaatacgattgatcatttcaccgccactttgcgtaacgcc
aaaaaaattttggttctgacgggcgctggagtttccacttctttaggtattcccgatttt
agatcatctgaggggttttattctaagatccgacaccttggattggaagaccctcaggat
gttttcaacttggatatattcttacaggacccttctgttttttacaatattgcccatatg
gttttaccaccagagaacatgtattctccgttgcacagcttcattaaaatgctacaagac
aagggcaaactattaagaaactacacacagaatatagataacttagaatcgtatgcaggg
atagatcctgataaattagtgcaatgtcacggttcattcgccactgcatcttgtgtgact
tgccattggcaaatacctggtgagaaaatattcgaaaatattagaaaccttgaactacca
ttatgtccctactgttatcaaaaaagaaaacaatattttcctatgagtaatggcaataat
acggtgcaaacaaacataaatttcaactcacccattttaaagtcgtatggtgttttgaaa
ccagacatgacattttttggcgaggccctgccatcgcgatttcataagaccatccgcaaa
gatatactggaatgcgatctattgatttgtataggaacaagtttgaaagtggctcctgtg
tctgaaattgtcaatatggtaccttcacatgttccgcagattttgatcaatagggatatg
gttacacatgcagagtttgacttaaacctgttgggattctgtgatgacgtggccagtctc
gtagctaaaaaatgccattgggatataccgcataaaaaatggcaagatctaaagaagata
gattacaactgtacggaaatagataaaggtacgtataagattaagaaacagccacgaaag
aaacaacagtaa

DBGET integrated database retrieval system