KEGG   Saccharomyces cerevisiae (budding yeast): YOL069WHelp
Entry
YOL069W           CDS       T00005                                 

Gene name
NUF2
Definition
(RefSeq) kinetochore-associated Ndc80 complex subunit NUF2
  KO
K11548  kinetochore protein Nuf2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YOL069W (NUF2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      YOL069W (NUF2)
    NMS complex
      YOL069W (NUF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nuf2 Mce4_CUP1
Motif
Other DBs
NCBI-GeneID: 854085
NCBI-ProteinID: NP_014572
SGD: S000005430
UniProt: P33895
Structure
PDB: 

Position
XV:198942..200297
Genome map
AA seq 451 aa AA seqDB search
MSRNQDVFPILDLQELVICLQSCDFALATQENISRPTSDYMVTLYKQIIENFMGISVESL
LNSSNQETGDGHLQEENENIYLDTLNVLVLNKICFKFFENIGVQDFNMTDLYKPEAQRTQ
RLLSAVVNYARFREERMFDCNSFILQMESLLGQLRSKFDDYNLIQQQLKQYEDVDGDNIP
DEQELQKLEEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESN
RDKLIKISNTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFETIISELYDV
LRIISSEVQESNRTETELVGLKQNLINNKLKLMNVLETGIMYKLEILQEQLDLQLKNLEK
LSQDTKEESRLNDTKLMDLQIKYENEIKPKIDKTDIFIQEELISGKINKLNDEIKQLQKD
FEVEVKEIEIEYSLLSGHINKYMNEMLEYMQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaatcaagatgtgttccccattttggatctacaggaactagttatatgtttg
caaagctgtgattttgcgctagccacacaggaaaatatctctaggcccacctcagactac
atggtaaccctttacaaacaaatcatcgagaacttcatgggtatttctgtagagtcgttg
ctgaatagtagtaaccaagaaacaggggatggtcacttacaggaagagaacgagaacatt
tatttggacacgttaaatgttttggtattgaacaaaatctgctttaagttctttgagaac
ataggtgttcaagatttcaatatgacagatttgtacaagcccgaagcccaacggacacag
cgcttactgagtgctgtggtgaattacgctcgttttagggaggaacgaatgttcgactgt
aattcttttattcttcaaatggaatcgttgctgggtcagcttcgctccaaattcgatgat
tataacttgattcagcaacagctaaagcaatacgaggacgtagatggggataatatacct
gatgagcaagagctccaaaagctggaagagcaaaataaggagctggaaattcagttgaag
aaattgaccaagatccaagaaacgttatccatagattataatgactataagatctccaag
cagtcaatctttaaagatctggaagctctgagtttccaaatagtggaattagagtccaat
cgagataaactgatcaaaatatccaatacagacatggaagagttatccgagggaatcaaa
gagctaaatgatctgttgatacaaaggaaaaagacgttagacgacttaaccgcacaacag
aaaaacttgcaagatacagtgacgacgttcgaaaccataattagtgagctctatgatgtg
ctgagaataatttccagcgaggtgcaagagtctaatcgaactgaaacggaacttgtggga
ttaaagcaaaatttaatcaacaataagctgaaattgatgaatgtattggaaacaggtatt
atgtataaattagaaatcttacaagaacagttagatttgcaactcaagaatttggaaaag
ctatcgcaagatactaaagaagagtcgcgcctaaatgatactaaattgatggatctacaa
atcaaatatgaaaatgaaatcaaacctaagattgacaaaacggacattttcattcaagag
gaactgatcagtggtaaaatcaataaattaaatgatgaaattaaacaattacaaaaagat
ttcgaagttgaagttaaagaaattgagattgaatattctttattatctggtcatattaat
aaatacatgaatgaaatgctcgaatatatgcaatag

DBGET integrated database retrieval system