KEGG   Saccharomyces cerevisiae (budding yeast): YOL086W-AHelp
Entry
YOL086W-A         CDS       T00005                                 

Gene name
MHF1
Definition
(RefSeq) Mhf1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-S CENP-T_C TFIID-31kDa Bromo_TP
Motif
Other DBs
NCBI-GeneID: 854067
NCBI-ProteinID: NP_076910
SGD: S000007626
UniProt: Q3E835
Structure
PDB: 

Position
XV:159173..159445
Genome map
AA seq 90 aa AA seqDB search
MNDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFA
RHAGRGVVNKSDLMLYLRKQPDLQERVTQE
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgatgaagatagagcccaactgaaggctaggctgtggatccgtgtggaagaa
cgattacaacaggtgttgtcctctgaggacataaaatacacaccgagattcatcaactca
ttgctggagttagcatatctacaattgggtgaaatggggagcgatttgcaggcatttgct
cggcatgccggtagaggtgtggtcaataagagcgacctcatgctatacctgagaaagcaa
cctgacctacaggaaagagttactcaagaataa

DBGET integrated database retrieval system