KEGG   Saccharomyces cerevisiae (budding yeast): YOL087C
Entry
YOL087C           CDS       T00005                                 

Gene name
DUF1
Definition
(RefSeq) Duf1p
  KO
K15361  WD repeat-containing protein 48
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOL087C (DUF1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     YOL087C (DUF1)
SSDB
Motif
Pfam: DUF3337 RAWUL
Other DBs
NCBI-GeneID: 854066
NCBI-ProteinID: NP_014554
SGD: S000005447
UniProt: Q99247
Position
XV:complement(155287..158637)
AA seq 1116 aa
MNQLTVSYGLISPDYCTSQDAHILPITKILYPDIPGKNYFLTSGRDGSIILHKNTQLSNE
PETAATTIKNDAIRMQVHSDWASDLIHVNMKNSDPSAGDTFISVSHDFSIVLISVNAQLT
TWDKKIIGDHDDYIKCIVPIHYEMSNDYELEEQEGGPDNVHDGINNGIVVDEQNNFLFVT
GGLDRKIKLWCLSSGPEKMATLLHTFDNAQSNDTGSIYSMSPIIPKYSFDDNQTSRPFDF
VAGDCNGDLIFYSCKYRKEVIRIQNAHRTNIKVVRTLDDSTRLISTSSDGVINVWDLNCR
HDQTTGALQLPKKIGSWSWDSSIWCVQGTSLDKLYFGDSQGNVMRANLSSYEDAKLTRIF
KPDHHHHHHHHHEHEEQNISTTDAKVKKYGGILDIALLPNEKLLFSFCTDSNLNVLDLTN
NHFSVNEGGFALTRSSLLTNRRHVITENTKGQMQRWDIVSCELLNTFDSSEGSFDDIVMK
YTSKEILSHWCTVSVKVGMLFVKINPKFLKTEVYGSALKDYQVVNNIEINSDERYNLGKI
VINSLFNEFISYEVQKDKLLRKKIFSLKKKDLTNSLTLDTGYNSESKKNNKDKKRKSTFK
ISSTLSIGNTNSSGTPPNSAPATPVMAETIVLEEQPLLQSASDKAIDDSLELVQPLPASK
KPYFRTQSSGSLLSRKFKSFRSTSGRATTGLNTPEEPKGILPDTPHVINDDSAFPQAINT
TQQSKDATPESMLWNHPFKLEQKLSAISSQDLPSNNTHNKLRSSENSRANSTSTLEGNEK
KKPEFMPDLLEQIQESYKQQYMNTSSLKYLTKRLPVTKIIKASSCPIIRVKSATLVLVHL
WKEGSCGGRVLFSTLLPPSHVDNETVSGGKENSKPPDDEEVDLQAVDDDKLGKYDLIDGE
LGSRLNRRQIFEQLEENLPYWFAKALFRDIKTVEEQPKLNFLIMPWSSVGGSEAAGNENK
KKFISASDTTESSGNDSSDSSLGNGNEAVSPSTQQQFHNMLKFGRPKTSEQELNPTDLPR
ISEANVKLVAPGMIRVKKIKLYVADRFETKTPEMKAKMEPSLWLDLLCRGQVLDNDMTLN
TVRTLYWKSQGDIVLEYRRKVHNSPLVHEVNGNEGK
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgaatcagttgacagtgagttatggcctaatttccccagattactgcacttcccaagat
gcgcacatcttaccgataacaaagattctgtacccggatatacctggtaaaaactatttt
cttacttcaggaagggatggttccataattttgcacaagaacacacagctctcgaacgag
cctgagactgctgcaactaccataaaaaacgatgcgataagaatgcaagttcatagcgat
tgggcaagcgatctaatacatgttaatatgaaaaattcagacccatctgcaggggacaca
ttcatatcagtaagtcacgatttttcgatagtattaattagtgtgaatgcgcagttaact
acctgggataagaaaataatcggtgaccacgacgattatatcaagtgcatagtgcccata
cattatgaaatgtcaaatgactatgaattggaagaacaagagggtggtcctgataatgta
cacgatggaataaataatggcattgttgttgatgaacagaacaactttctttttgtgaca
ggtggtctagatagaaaaatcaaactttggtgcctgagcagcgggccagaaaaaatggct
acgctactacacacatttgataatgcacaatcaaacgacacaggctcaatatactccatg
agtcccatcatcccaaaatacagttttgatgacaatcaaacgtctcgtccctttgatttt
gttgccggagactgtaatggtgatttgattttttattcgtgtaaatatcgtaaggaggtg
ataagaattcaaaacgcccacagaacaaatataaaagtagtaagaactcttgatgactcc
acacgactaatcagtaccagctcagatggtgtaataaatgtatgggacttgaattgtagg
catgatcagactactggtgcccttcagcttcccaaaaaaattggatcttggtcctgggat
tcttccatatggtgtgtccaaggaacgagccttgataagttgtattttggtgactctcag
ggcaatgttatgagagcaaacttatccagttatgaagatgctaaacttacaagaattttc
aagcctgatcatcaccaccatcatcatcatcaccatgaacacgaagagcaaaatatatca
actacagatgcgaaagtaaaaaaatatggtggtatccttgatattgcccttttacctaat
gaaaaattgttgttttctttttgtactgactcaaatctaaacgtgctcgatttaactaat
aaccatttcagtgtcaacgaaggtgggttcgcactgaccagaagctcactgctaaccaac
aggaggcatgtaataacggaaaacactaaaggccaaatgcagagatgggatatcgtttca
tgtgagcttttgaatacttttgattcatcagaaggttcatttgatgatattgtaatgaaa
tacacctcaaaggaaattctatctcattggtgtactgtttccgttaaggtcggtatgctg
ttcgtaaaaataaacccaaaatttctgaaaactgaagtttatggatccgcgctaaaggat
tatcaggttgtgaacaatattgaaattaactcagatgagagatataatttgggtaaaatt
gttattaattcgcttttcaatgagttcatatcatatgaagtccaaaaggataaactttta
aggaagaaaatttttagtttgaagaaaaaagacttaaccaattcattaaccttggatacg
ggatataacagtgaatcaaaaaagaataataaagataaaaagagaaaatcaaccttcaaa
attagttcaactctgtccattggaaataccaacagcagtggaactccaccaaattcggca
cctgcaaccccggtaatggcagagactatagtattagaagaacaaccattgttgcagtca
gcttctgataaagcaatagatgactctttagaactcgtgcaaccattgcctgcatccaaa
aagccatattttagaacgcagagctctggctccttgttaagtagaaagttcaaatcattt
aggtctacttctggtcgtgccacaacagggttaaacactccagaggagcccaaaggaatt
ctgccagatactccgcacgttattaatgatgactcggccttccctcaagctatcaataca
actcagcagtctaaggatgcaactccagaatctatgttatggaatcatcctttcaagcta
gagcaaaaactatccgctatttcatcacaagatttaccgagtaacaacactcataacaaa
ctaagatcatctgaaaactcaagggcgaattccacgtcaaccttggaaggcaacgaaaag
aagaagcctgagttcatgcccgatttactggagcaaattcaagagtcttacaagcaacaa
tatatgaatacttcttctctaaaatacctgacgaagaggcttccagtcaccaagataatc
aaggctagttcatgtccaattattagagtaaaatctgccacgttagttttggtccatctt
tggaaggaaggctcatgtggtggcagggtattattttccaccctattaccgccatctcat
gtcgataatgaaaccgtcagcggcggcaaagaaaattccaaaccgccagatgatgaagaa
gtagaccttcaagctgtagatgatgacaaattaggaaaatatgatcttattgatggcgag
ttaggaagcagactcaacagaaggcaaatttttgagcaattggaggaaaatttgccctac
tggtttgcaaaagctttatttagagatattaagacggtggaagagcaaccaaagttgaac
ttcttaatcatgccatggtcttctgttggtgggagtgaggcagctggcaatgaaaacaag
aagaagtttattagtgcatcagataccacagaatcttctggcaacgatagtagcgatagc
agccttggaaatggtaatgaagccgtttccccatcaacacagcaacagttccataatatg
ctaaagtttggccgtccgaagaccagcgagcaggagttaaaccccacagatttaccgaga
atctctgaggcgaatgtcaagctggttgcgcctggaatgattagggtgaaaaaaattaaa
ctttacgtcgctgacagatttgaaacgaaaactcctgaaatgaaagcaaaaatggaacct
agtctttggttggatctactatgtaggggccaagtgcttgataacgatatgactttaaat
accgttagaacactttactggaaatctcagggtgacatagttctagaatacagaagaaaa
gtacataattcaccgctagttcatgaggtcaacgggaatgaggggaaatga

DBGET integrated database retrieval system