KEGG   Saccharomyces cerevisiae (budding yeast): YOL103W
Entry
YOL103W           CDS       T00005                                 

Symbol
ITR2, HRB612
Name
(RefSeq) myo-inositol transporter ITR2
  KO
K08150  MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOL103W (ITR2)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   YOL103W (ITR2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YOL103W (ITR2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_3
Other DBs
NCBI-GeneID: 854050
NCBI-ProteinID: NP_014538
SGD: S000005463
UniProt: P30606
Position
XV:124001..125830
AA seq 609 aa
MKNSTAASSRWTKSRLSHFFPSYTNSSGMGAASTDQSSTQGEELHHRKHCEEDNDGQKPK
KSPVSTSTMQIKSRQDEDEDDGRIVIKPVNDEDDTSVIITFNQSISPFIITLTFVASISG
FMFGYDTGYISSALISINRDLDNKVLTYGEKELITAATSLGALITSVGAGTAADVFGRRP
CLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLT
VINSLWLTGGQLIAYGCGAGLNHVKNGWRILVGLSLIPTVLQFSFFCFLPDTPRYYVMKG
DLKRAKMVLKRSYVNTEDEIIDQKVEELSSLNQSIPGKNPITKFWNMVKELHTVPSNFRA
LIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFVFTLIAFFCIDKI
GRRYILLIGLPGMTVALVICAIAFHFLGIKFNGADAVVASDGFSSWGIVIIVFIIVYAAF
YALGIGTVPWQQSELFPQNVRGVGTSYATATNWAGSLVIASTFLTMLQNITPTGTFSFFA
GVACLSTIFCYFCYPELSGLELEEVQTILKDGFNIKASKALAKKRKQQVAEGAAHHKLKF
EPTQEIVES
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgaagaattcgacagctgctagttccagatggacgaagagtcgtctctcccatttcttt
ccctcgtacactaatagcagtggtatgggggccgcctcaactgatcaatcttctacgcag
ggagaagaactgcaccataggaagcactgtgaagaagacaatgatggtcaaaaaccgaaa
aagtctcccgtatccacctctacaatgcaaataaaatctagacaggatgaggacgaggat
gacggtcgaattgtcattaaaccagttaacgatgaagatgatacatcagtgattataact
ttcaatcagtcaatatccccttttattattacattgacattcgttgcgtccatttctggg
ttcatgtttggttatgatactggttacatatcgagtgcgctaatttctatcaatagagat
ttagacaacaaagttttaacttatggagaaaaagaattaattacggccgccacatcattg
ggcgctttgattacaagtgtgggcgctggtactgctgctgatgtgtttggaagaagacca
tgtttaatgttctccaatctgatgtttttgatcggagcaattttacaaattaccgcgcac
aagttttggcaaatggcggccggtagactgattatgggtttcggtgtcggtattggttct
ttgatttctcctctttttattagtgaaattgctcctaagatgatcaggggtaggttaacc
gttataaattccctatggctgacaggtggtcaattgattgcttacggttgtggtgcgggc
ctgaaccacgtcaaaaacggttggagaatcttagttggtttgtccttgatacctactgtt
ttgcagttttcttttttctgttttttgccggatacaccaagatactacgtaatgaaaggc
gatttaaagagagcaaaaatggttctcaaacgaagttacgtaaacactgaagatgaaata
attgatcaaaaagttgaagaattatctagcttaaatcaatcgataccaggaaaaaatcca
ataacaaaattctggaatatggtcaaggaattgcacactgtgccttcaaatttcagagct
ttgattattggttgtggtctacaagccattcaacaattcacaggttggaattccttaatg
tatttctccggtacaatatttgaaactgttggattcaaaaattcttctgccgtttctatt
attgtctcaggtactaattttgtgttcacattaatagcatttttctgtattgataaaatc
ggccgtaggtacattttactgattggactacctggtatgactgtggcgctggttatatgt
gctatagcgttccatttcctaggtattaagtttaacggtgctgatgcagtagtggcatct
gatggattttcatcttggggcattgtcattatcgtatttattattgtgtatgcagccttt
tatgccctcggtatcggcactgttccatggcaacaatcggaattatttccacaaaacgtc
agaggtgtagggacatcctacgctactgccaccaattgggcaggttctttagtcattgcg
tctacgttcttgactatgttacaaaatattacaccaacgggtacattttcattctttgcc
ggtgtagcatgtttatcaaccattttttgttacttttgttatccagaactatcaggattg
gagttagaggaagttcaaacaattttaaaggacggattcaatatcaaagcctctaaagct
ctagctaaaaagaggaaacaacaggtggccgaaggtgctgcccatcataaactcaaattc
gaacctacacaggaaattgtagaaagttag

DBGET integrated database retrieval system