KEGG   Saccharomyces cerevisiae (budding yeast): YOL115WHelp
Entry
YOL115W           CDS       T00005                                 

Gene name
PAP2, TRF4
Definition
(RefSeq) non-canonical poly(A) polymerase PAP2
  KO
K03514  non-canonical poly(A) RNA polymerase PAPD5/7 [EC:2.7.7.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00393  TRAMP complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YOL115W (PAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YOL115W (PAP2)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOL115W (PAP2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     YOL115W (PAP2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     YOL115W (PAP2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA degradation factors
   TRAMP complex
    YOL115W (PAP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_2 PAP_assoc Polbeta DNA_pol_B_palm RD3
Motif
Other DBs
NCBI-GeneID: 854034
NCBI-ProteinID: NP_014526
SGD: S000005475
UniProt: P53632
Structure
PDB: 

Position
XV:101475..103229
Genome map
AA seq 584 aa AA seqDB search
MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEILPSRNEQETNKL
PKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPSTTEESKTPSLAVHGDEKDLANN
DDFISLSASSEDEQAEQEEEREKQELEIKKEKQKEILNTDYPWILNHDHSKQKEISDWLT
FEIKDFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCV
VTSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTN
GIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHMHPR
IITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFS
LAIQDPGDESNNISRGSFNIRDIKKAFAGAFDLLTNRCFELHSATFKDRLGKSILGNVIK
YRGKARDFKDERGLVLNKAIIENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEIT
NPPAKKAKIEEKPESEPAKRNSGETYITVSSEDDDEDGYNPYTL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaaagagtgtaacagcctcttcttcaaagaagattaaaaaccggcataatggg
aaagtgaaaaagagcaagaaaatcaagaaagtacggaaaccacagaagtctatatccttg
aacgacgaaaacgaagtagagattttacctagtcgtaatgagcaagagacaaataaatta
cctaaagatcacgtcacggcggatggaattcttgtattagaacataaatctgatgatgat
gaaggattcgatgtctacgatggacatttcgataaccctactgatattccctcgactact
gaagaaagtaaaacgccttcattagcagtgcacggggatgagaaggatcttgctaacaat
gatgattttatctctctttctgctagttctgaggatgagcaagccgaacaggaagaggag
agggagaaacaagaattagaaattaaaaaagaaaagcaaaaggaaatccttaatactgat
tatccatggattttaaatcatgatcactccaaacagaaagaaatctcggactggctaacc
tttgaaatcaaggattttgttgcctatatctcaccaagtcgtgaagaaattgaaattcgt
aatcaaaccataagtacaataagagaggctgtcaaacagttatggccagatgctgatttg
cacgtgtttggatcatattctaccgatttgtatttgcctggttccgatattgattgcgtg
gtaacgagcgaacttggtggtaaggaaagtaggaataacttgtattcgttagcaagccat
ttaaaaaaaaaaaatttggcaacagaggttgaagttgtcgccaaagctcgcgttccaatc
atcaagtttgttgagccacattcagggatccacatagatgtttcatttgagagaacaaat
ggtattgaagcagcaaagcttattagagagtggttggacgatacccccggcctgagagaa
ttagtccttatcgtaaaacaattcctacacgcaagaagactaaataatgtgcataccggt
ggtcttggtgggtttagtattatatgtcttgtcttttcctttttgcatatgcacccacgt
ataataactaacgaaatagatccaaaggacaacttgggtgtgctcctgatagagtttttt
gaactttatgggaaaaattttggttatgatgatgttgcactgggatcatcggatggatat
ccagtatactttccaaaatcgacatggagtgctattcagcctattaaaaatccattttca
ttggccattcaagatccaggtgatgaatcaaataacatcagtcgagggtcctttaacatt
cgagatattaaaaaggcatttgctggtgcttttgatctgttgacgaatagatgttttgaa
ttacattcagcaacttttaaggatcgattggggaaaagtatattgggaaacgtgatcaaa
tatcgtggaaaggcaagagatttcaaggatgaaagaggtctagtactgaataaggctatt
attgaaaatgaaaactatcacaagaaacgtagcagaataattcatgatgaagattttgcc
gaagatacagttacctccacagccaccgctaccacaacagatgatgattatgaaataacg
aacccacctgctaagaaggctaaaatagaagaaaaacctgaaagtgaaccggccaagaga
aatagtggagagacatatatcactgtctctagcgaagatgatgatgaagatggatataat
ccttataccctttaa

DBGET integrated database retrieval system