KEGG   Saccharomyces cerevisiae (budding yeast): YOL125WHelp
Entry
YOL125W           CDS       T00005                                 

Gene name
TRM13
Definition
(RefSeq) tRNA:m4X modification enzyme
  KO
K15446  tRNA:m4X modification enzyme [EC:2.1.1.225]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOL125W (TRM13)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.225  tRNA:m4X modification enzyme
     YOL125W (TRM13)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    YOL125W (TRM13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRM13 zf-TRM13_CCCH zf-U11-48K
Motif
Other DBs
NCBI-GeneID: 853995
NCBI-ProteinID: NP_014516
SGD: S000005485
UniProt: Q12383
Position
XV:83834..85264
Genome map
AA seq 476 aa AA seqDB search
MLQDNNGPAVKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHN
KNGSEAEKERERVPCPLDPNHTVWADQLKKHLKKCNKTKLSHLNDDKPYYEPGYNGENGL
LSSSVKIDITAEHLVQSIELLYKVFEGESMDELPLRQLNNKLMSLKRFPQLPSNTKHAVQ
QSSLIENLVDAGAFERPESLNFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFV
LIDRATNRMKFDKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMDPILKSTPGDDI
QYVCISKHLCGVATDLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNR
SYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRKPGTAITDIVNVVESFEGAEPYT
ITIKERENIGLMARRVIDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAMLVYKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagataataatgggcccgctgttaagagggcgaaaccctcagaaaggttgcaa
tgtgaatatttcatggaaaaaaagaaacgaagatgtgggatgaccaggagttctcagaac
ttgtattgttcagagcatctgaatttgatgaaaaaggcggctaattctcaagtgcataat
aagaatggcagtgaagcagagaaagaaagagaaagagtaccttgtccgctggatcctaac
catacggtttgggcagatcaattaaaaaagcatttgaaaaaatgcaacaagaccaaacta
agccatttaaacgatgataagccatactatgaaccgggctataacggagagaatggactg
ttatcgtcgtctgttaaaatagatattactgcggaacatttggtacaatctattgaattg
ctgtataaggtgtttgagggagaatccatggacgagctgcctttgagacaactgaacaat
aagcttatgtctctaaaacgattccctcaattgccttcgaatactaaacatgctgtacaa
cagtcttcactgatcgaaaacttagtggacgctggcgcatttgagaggccagaaagttta
aacttcattgagtttggatgtggcagggccgaattctcgcgctatgtcagtctgtacctt
ttaacacaattgacaagccttccagcggagcactcgggttcaaactcgaacgagttcgtg
ttgattgacagagcaactaataggatgaagttcgataaaaagataaaagacgatttttca
gaaataaagtcaaactcaccttccaaacctattagctgccccagcatcaaaaggataaag
atcgacattagggacttgaagatggatccgattttaaaatcgacacctggggacgatata
caatacgtgtgcatctcaaaacacctttgtggtgtagctacagatctaactttgaggtgt
ataggcaacagctcaattttacatggcgacgataacaacggatgcaaccccaaactaaag
gcaatttgtattgccatgtgctgcaggcatgtctgtgactacggcgactatgtcaaccgc
agttacgttacatcacttgttgaaaagtatagggcccatggctccatcttgacgtacgaa
acctttttccgcgttttaactaaactctgttcatggggtacctgcggaaggaaaccaggt
acggctattacagatatagtaaacgttgtcgaatcgtttgaaggggctgagccatataca
ataaccattaaagagagagaaaatattggattaatggctaggcgtgtaatcgacgagggc
aggttggtatatgtgaaagaaaagtttacagagtttaatgcggagctgataaggtacgta
gaatccgatgtttctttagagaacgttgctatgttagtttataagaaatag

DBGET integrated database retrieval system