KEGG   Saccharomyces cerevisiae (budding yeast): YOL128C
Entry
YOL128C           CDS       T00005                                 

Gene name
YGK3
Definition
(RefSeq) serine/threonine protein kinase YGK3
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YOL128C (YGK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YOL128C (YGK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 853992
NCBI-ProteinID: NP_014513
SGD: S000005488
UniProt: Q12222
Position
XV:complement(78352..79479)
AA seq 375 aa
MLKVNNVFGSNPNRMTKLEDEHYFIDDIVSIKNRQKSKMYVREGKRIGHGSFGTVTQSIL
SSNSIEWLGPYAIKRVVKSPKVQSLELEILQNIRHPNLVTLEFFFESHCTTKDGGHLYQK
NFVMEYIPQTLSSEIHEYFDNGSKMPTKHIKLYTFQILRALLTLHSMSICHGDLKPSNIL
IIPSSGIAKVCDFGSAQRLDDNTELKTYFCSRFYRAPELLLNSKDYTTQIDIWSLGCIIG
EMIKGQPLFKGDSANSQLEEIAKLLGRFPKSSIKNSQELQDSLNDQKFKKFMHWFPSIEF
FDVEFLLKVLTYDATERCDARQLMAHEFFDALRNETYFLPRGSSMPVHLPDLFNFSASEK
RALGEYYNLIVPSLD
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcttaaagtgaataacgttttcgggagcaaccccaatagaatgacaaaattggaggat
gaacactactttatcgatgacatcgtatcgattaaaaacagacaaaagagcaaaatgtac
gtcagggaagggaaacggataggccacggctcgtttggaactgtgacacagtccattctg
tcgagcaatagtattgaatggctaggaccttatgccataaaaagagtagtgaaatctccc
aaagtacaatctttggaattggagatcttacagaatatcagacatccaaatctggttact
ttagagttcttcttcgagagccactgtactaccaaggacggtgggcacttatatcagaaa
aactttgttatggaatacattcctcaaaccttaagttctgaaattcatgaatattttgac
aatggttctaagatgcctacaaaacatatcaagctgtacacattccaaatacttcgagca
cttctgaccttacattccatgagtatatgccatggcgatctgaaaccgagcaatatattg
attataccaagtagcggtattgctaaagtgtgtgactttggctcggcacagcgactggat
gataatacagaattgaagacctatttttgctcgaggttttatagagcacctgaacttctc
ctaaattcgaaggattatacaactcaaatagatatatggtcgcttggttgtataataggc
gaaatgataaaaggccagccactttttaaaggcgatagcgctaactcacaactggaggag
atagctaaactattaggccgctttcctaaaagttctataaaaaattctcaagagttacag
gatagcttaaatgaccaaaaattcaagaagtttatgcattggtttccctctatagaattt
tttgatgtggaattcttgctaaaggtgttgacgtatgatgccactgaaaggtgcgatgct
agacaattgatggctcacgaattttttgacgcgttaagaaatgaaacctattttttgcca
agaggttcgagtatgccggttcacctaccagacctctttaattttagtgcatcggagaaa
agggctcttggagagtattacaacttgattgtgccatctctggattag

DBGET integrated database retrieval system