KEGG   Saccharomyces cerevisiae (budding yeast): YOL137WHelp
Entry
YOL137W           CDS       T00005                                 

Gene name
BSC6
Definition
(RefSeq) Bsc6p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 853983
NCBI-ProteinID: NP_014504
SGD: S000005497
UniProt: Q08280
Position
XV:65621..67114
Genome map
AA seq 497 aa AA seqDB search
MDASSVPPKVDDYGMYTTEISHHNPIELKNLLSSSDSRRNSQDEDSLPNNTNLIKEIDWQ
GEKVKTYPLNYQTVPLVKLQVIACLIMFVVFGMNDQTVGALLPTLIEYYHISRVDVSNVF
IVQLCGYVMASLSKERLNKHFGMRGGMLLAAGLCIVFLIILATAPSSFYVCMFCGLPLGL
GIGILDSTGNVLMGSLLVHKNELMGIMHGLYGAAAMVTPPLVSYFVEWGHWSLFFLIPLF
FSIIGMIVIFPAFKFETASKYDYLCSVENKESNNDVEEAGDNSLMESTKASPGFFELLRN
PAIFLYSLYLFLYLGAEITTGSWFFSYLLETKSSNKVAMSYIAASFWTGLTVGRLCLGFV
TERFFENEYKASKAYAFLTLSSYTLFVLVGLINSSSVFYFVVLFFVVFCCGTFIGPLFPN
ASIVALQVLPKRLHVSGVGVAVAVGGCGGAAIPYLAGVIAHTVGIQYIPLLCWIMVALFT
LEWTLYPKFIKGHEEYF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatgcttcctcggttccaccaaaggtagatgattatggaatgtatacaactgaaatt
tcacatcataacccaatagagttgaaaaatctgctatcatcatcagactccagaagaaat
tctcaagatgaagatagtctacctaacaatacaaacttaatcaaagaaattgactggcag
ggcgagaaagttaaaacatatccactaaactatcaaactgtaccactagtaaagctgcag
gtgatagcatgcttgattatgttcgtagtctttggtatgaacgatcaaacagtaggtgca
ctacttcctacgctaattgaatactatcatatatcgcgggtagatgtctcaaacgtattt
atagtccaattatgtggttatgtgatggcgtctttatcaaaagagagattgaataagcac
tttggtatgagaggtggtatgcttctagcagctggtttgtgtatagtatttcttatcatt
ttagcaactgcaccttctagtttctatgtttgtatgttttgtggccttcctcttggttta
gggatcggcatcttagattctaccggtaatgttttaatgggcagtcttttagtccataag
aatgaactcatgggtatcatgcatggtctttacggggcagcagctatggttactcctccc
ttagtttcatattttgttgaatggggtcattggtctctttttttccttattcctctgttc
ttttctataataggcatgattgtaatcttcccagcttttaaatttgaaactgcaagtaaa
tacgactacctctgctctgtggaaaacaaagaaagcaacaatgatgtggaagaagcgggt
gataactcgctgatggaatctaccaaggcgagcccaggattttttgaacttttaagaaat
cctgctattttcttgtactcattgtatttgttcctttacttaggtgctgaaattacaact
ggttcatggttctttagttatttattggaaactaaatcaagtaataaggttgctatgtca
tacatagcggcatcgttttggacaggtttgactgtaggcaggttgtgtctaggatttgtt
actgaaagattcttcgaaaacgagtataaagcaagcaaagcgtacgcttttttaactcta
tcttcatacaccttatttgtgcttgttgggttgatcaattcaagctcagttttctatttc
gtcgtgttattttttgttgttttttgttgtggtacgtttatcggaccattattcccaaac
gcaagtatagttgcattacaagtattgcccaaaagactacatgtgagcggggttggggtt
gccgtcgccgttggtggttgtggtggtgcagccattccatatttggctggagttattgca
cacacagtgggaatccagtatatcccactattgtgttggattatggttgcgttatttaca
ttggaatggacattgtatcctaaattcataaaagggcatgaagaatatttttag

DBGET integrated database retrieval system