KEGG   Saccharomyces cerevisiae (budding yeast): YOL139CHelp
Entry
YOL139C           CDS       T00005                                 

Gene name
CDC33, TIF45
Definition
(RefSeq) translation initiation factor eIF4E
  KO
K03259  translation initiation factor 4E
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Module
sce_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YOL139C (CDC33)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YOL139C (CDC33)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YOL139C (CDC33)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    YOL139C (CDC33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 854026
NCBI-ProteinID: NP_014502
SGD: S000005499
UniProt: P07260
Structure
PDB: 

Position
XV:complement(60383..61024)
Genome map
AA seq 213 aa AA seqDB search
MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSD
LLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLR
GKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGG
KFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgaagaagttagcaagaagtttgaagaaaacgtttcagtcgatgataccaca
gctactccaaagactgttttaagtgacagtgctcacttcgatgtcaagcacccattgaac
accaaatggactttatggtacacaaagccagccgtcgataaatctgagtcgtggtctgat
ctattacgtcccgtcacttcattccaaactgttgaagaattttgggctatcattcaaaat
attcctgagccacacgaactaccattgaaatcagattaccacgtcttccgtaatgacgtt
agacctgaatgggaagatgaagccaatgctaaaggtggtaaatggtctttccaacttaga
ggaaaaggtgctgatattgatgaattatggctaagaactttactagcagttattggtgaa
acaattgatgaagacgactcccaaattaacggtgtcgttttaagcattagaaaaggtggt
aacaagtttgccttatggactaaatctgaagacaaagaaccactattgagaattggtggt
aaattcaagcaagttttaaaattaaccgatgacgggcatttggaattctttccacattcc
agtgccaatggtagacaccctcaaccatcaatcaccttgtaa

DBGET integrated database retrieval system