KEGG   Saccharomyces cerevisiae (budding yeast): YOL156W
Entry
YOL156W           CDS       T00005                                 
Symbol
HXT11, LGT3
Name
(RefSeq) hexose transporter HXT11
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOL156W (HXT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOL156W (HXT11)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YOL156W (HXT11)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF5320
Other DBs
NCBI-GeneID: 854009
NCBI-ProteinID: NP_014486
SGD: S000005516
UniProt: P54862
Position
XV:25273..26976
AA seq 567 aa
MSGVNNTSANELSTTMSNSNSAVGAPSVKTEHGDSKNSLNLDANEPPIDLPQKPLSAYTT
VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNI
GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGI
AVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA
WATFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEK
LAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSI
IIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITS
QGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFF
TPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVP
PERRTADYDADAIDHDNRPIYKRFFSS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtcaggtgttaataatacatccgcaaatgagttatctactaccatgtctaactctaac
tcagcagtaggcgctccctctgttaagactgaacacggtgactctaaaaattcccttaac
ctagatgccaatgagccacctattgacttacctcaaaaacccctctctgcgtataccacc
gtcgcaatcctgtgtttgatgattgcatttggcggcttcatctttggttgggataccggt
accatttctggttttgttaacctttctgatttcatcagaaggttcggtcaaaaaaatgac
aagggaacctactacttatcgaaagtaagaatgggtttgatcgtctcaatattcaacatt
ggctgcgccataggcggaattgtcttgtcaaaagtcggtgatatatatggtcgtcgtatt
ggattgattacagttactgccatttacgttgtaggcatcctaatccaaataacttccata
aacaagtggtaccaatacttcattggaagaattatttctggcctaggagtgggaggcatt
gctgtcctttccccaatgttgatatctgaagttgctcccaaacatatcagaggaactctg
gtccaattgtaccagctgatgggtacgatgggtatttttctaggatactgtaccaattac
ggtaccaagaactatcacaacgccactcaatggagagtcggccttggtctttgctttgcc
tgggctacattcatggttagtggaatgatgtttgtaccagaatcaccacgttacctgatt
gaggttggtaaagatgaggaagcgaaacgttcactatcgaaatccaacaaagtctcagtt
gacgatccagccttgctagttgaatatgacactataaaggcaggaattgaacttgaaaag
ctggcaggtaacgcatcatggtctgaactactctccactaaaacaaaggtctttcagcgt
gttctcatgggagtgatgatccaatcgctgcagcaattaaccggtgacaactacttcttt
tactacggtaccaccatcttcaaatctgtcggtctaaaggactcctttcagacttcgatc
attatcggtgtggttaattttttctcttcattcatagcggtatacaccattgagaggttt
ggacgccgtacgtgtctattgtggggtgctgcttctatgctatgctgctttgctgtgttt
gcctccgtcggtgtgacaaagttgtggcctcaaggaagcagtcaccaagacattacttct
cagggcgccggtaactgtatgattgtgtttactatgttcttcattttttcgttcgccacc
acttgggcaggcggctgttacgttattgtctcagagacgtttcctcttagggtcaaatca
agaggaatggcaatcgcaacagctgcaaactggatgtggggtttcctgattagtttcttt
accccattcattaccggggcaatcaacttttactacggttacgtattcttaggctgtctg
gtttttgcatacttttatgtctttttctttgtcccagaaacaaaaggcctgacactggag
gaggtgaatactatgtggctggaaggtgtgccagcatggaaatcggcctcatgggtgcca
ccggagagaagaaccgcagattacgatgctgatgcaatagatcatgacaatagaccaatt
tacaagaggttcttttccagctga

DBGET integrated database retrieval system