KEGG   Saccharomyces cerevisiae (budding yeast): YOR014WHelp
Entry
YOR014W           CDS       T00005                                 

Gene name
RTS1, SCS1
Definition
(RefSeq) protein phosphatase 2A regulatory subunit RTS1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YOR014W (RTS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOR014W (RTS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YOR014W (RTS1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR014W (RTS1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     YOR014W (RTS1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     YOR014W (RTS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B56
Motif
Other DBs
NCBI-GeneID: 854179
NCBI-ProteinID: NP_014657
SGD: S000005540
UniProt: P38903
Position
XV:357674..359947
Genome map
AA seq 757 aa AA seqDB search
MMRGFKQRLIKKTTGSSSSSSSKKKDKEKEKEKSSTTSSTSKKPASASSSSHGTTHSSAS
STGSKSTTEKGKQSGSVPSQGKHHSSSTSKTKTATTPSSSSSSSRSSSVSRSGSSSTKKT
SSRKGQEQSKQSQQPSQSQKQGSSSSSAAIMNPTPVLTVTKDDKSTSGEDHAHPTLLGAV
SAVPSSPISNASGTAVSSDVENGNSNNNNMNINTSNTQDANHASSQSIDIPRSSHSFERL
PTPTKLNPDTDLELIKTPQRHSSSRFEPSRYTPLTKLPNFNEVSPEERIPLFIAKVDQCN
TMFDFNDPSFDIQGKEIKRSTLDELIEFLVTNRFTYTNEMYAHVVNMFKINLFRPIPPPV
NPVGDIYDPDEDEPVNELAWPHMQAVYEFFLRFVESPDFNHQIAKQYIDQDFILKLLELF
DSEDIRERDCLKTTLHRIYGKFLSLRSFIRRSMNNIFLQFIYETEKFNGVAELLEILGSI
INGFALPLKEEHKVFLVRILIPLHKVRCLSLYHPQLAYCIVQFLEKDPLLTEEVVMGLLR
YWPKINSTKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWN
NEYFLNLCIENAEVILPIIFPALYELTSQLELDTANGEDSISDPYMLVEQAINSGSWNRA
IHAMAFKALKIFLETNPVLYENCNALYLSSVKETQQRKVQREENWSKLEEYVKNLRINND
KDQYTIKNPELRNSFNTASENNTLNEENENDCDSEIQ
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtggtttcaagcaaagattaataaagaagaccaccgggtcttcttcttcttca
agcagtaaaaagaaggacaaagagaaggaaaaagaaaaaagttccactacctcatccaca
tcaaagaagcccgcttcggctagtagctcttcccacgggactactcacagttctgccagc
agtaccggatcaaagtctacaactgagaagggcaagcaatctggtagtgttccctcgcaa
gggaagcatcatagtagctctacatcaaaaacaaaaacagcgacgaccccttcttccagc
agcagtagcagtagaagttcaagtgtcagtcgctccggttcaagctccacaaagaaaaca
agttcaagaaaaggacaagaacagtccaaacaatcgcaacagccatcacaatctcaaaag
caaggatcttcttcatcatctgccgctataatgaaccccactccagtactcactgttact
aaggacgacaaaagcacttctggtgaagatcatgcacatcctactttgctgggggcagta
tccgctgttccatcatctcccatttcaaatgcttcaggtacagcagtttcttctgatgta
gaaaatggtaatagtaataataacaatatgaatattaatactagtaatactcaggatgca
aaccacgcctcctcacaaagtatcgacattccgagatcatcacactcatttgagagacta
ccaacacccacaaaacttaaccctgacacagatttagagttaattaagactccccaacgt
cattcttcatctagattcgagccatctagatatacgccattaacgaaattgccaaatttt
aatgaagtttctcctgaagaaagaatccctttgttcattgccaaagttgaccagtgtaac
actatgtttgactttaatgatccaagttttgacattcaaggtaaagagattaaaagaagc
accttagatgagctaatagaattccttgtaacaaataggttcacttacacgaatgagatg
tacgctcatgtggtgaacatgttcaaaatcaatctgtttagacctattccaccaccagta
aatccagttggtgacatttatgacccagatgaagatgaacctgttaacgaactagcctgg
cctcatatgcaagctgtttacgaattctttttaaggtttgtggaaagtcctgatttcaat
catcagattgctaaacaatatattgatcaggactttattttaaagttactggaattattt
gatagcgaagatatcagagaaagagactgtttgaaaacgacactgcatagaatatatggg
aagttcttatcattaagaagctttattcgtcggtcgatgaataatatttttttgcaattt
atttatgagactgagaagtttaacggtgtggcagaattgttagaaattttgggttccata
attaatggatttgcacttccattaaaggaagagcacaaggttttcttggtgaggatattg
ataccattacacaaggtccgttgtttatcattataccaccctcagttggcttactgtatc
gttcaatttctcgaaaaagatcctttattaaccgaagaggtagttatgggcttactgcgt
tattggccaaaaataaattccacaaaagagataatgtttctaaatgaaatcgaggatatt
tttgaagtgatcgaaccgctggaatttattaaagtagaagttccgttatttgttcaatta
gctaagtgtatttcttctccacatttccaagtggcggaaaaggttttaagttattggaat
aatgaatatttcttaaacttatgtatcgaaaatgccgaagtcatcctacccattatattt
cctgcattatatgaattaacttctcagttagagctagatacagcaaatggcgaagatagc
atttcagacccttacatgcttgttgagcaagcaatcaattctggttcgtggaatagggca
attcatgctatggcattcaaggcattgaaaatttttctggaaacaaacccagtattgtac
gaaaactgtaatgcattgtacttatcaagtgtaaaagaaactcaacagcgtaaggtgcaa
cgtgaagaaaattggagcaaacttgaagaatatgtaaaaaatctaaggattaacaatgat
aaggaccaatacacaatcaaaaacccagaattaagaaacagtttcaacacagcaagtgag
aataacacattaaatgaagagaacgaaaatgattgtgacagcgagatacagtga

DBGET integrated database retrieval system